KEGG   Lactobacillus reuteri SD2112: HMPREF0538_21365Help
Entry
HMPREF0538_21365  CDS       T01551                                 

Definition
M20/M25/M40 family peptidase (EC:3.5.1.18)
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
lru  Lactobacillus reuteri SD2112
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:lru01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:lru00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1375131..1376048)
Genome map
AA seq 305 aa AA seqDB search
MEVSEKVKVLQDLIKIHSVNGNEVEVARYLQKLLANHGIDSKVDEFGDRRANLIAEIGTG
ESKKILGLTGHQDTVAVPNPDRWQHDPFGGEISGDYIFGRGAADMKSGLAAQAIVLIELK
EAGQLPSGTVRFIATAGEELGTPGAYRLQKQGVADDLDALVVGEPTGGNVIFAHSGSMNY
RVTSYGKSCHSSHPQNGINAIEGLLKFIEEEKHLFDNTKDDQYLGKVQHSITVIDGGSQV
NTIPDSASLQGNIRPTASFNNVKVADRLNDALEYINHTTPFQLELVDYRMKLATQLVVNK
KRHSA
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atggaggtcagtgaaaaagtcaaagtactgcaggatttaataaaaatccattctgttaat
ggaaatgaagttgaagtagcacgctacttacaaaaacttttagcaaatcacggaatcgat
tcaaaagttgatgaatttggtgatcgccgtgcaaacttgattgcggaaattgggactggg
gaaagtaaaaaaatccttgggctcactggacaccaagacactgtggcagtacctaatcca
gaccgctggcaacatgatccctttggcggtgaaattagtggtgattatatttttggtcgt
ggagctgctgacatgaagagcggtctggctgcccaggctattgtattaatcgaattaaaa
gaagctgggcaactgccatcaggaactgttagatttattgctaccgccggagaagaactt
ggtactcctggagcttatcgtttacaaaagcaaggagttgccgatgaccttgacgcatta
gtagtcggcgaaccaaccggtgggaatgttatttttgctcactcggggagtatgaattac
cgcgttaccagttatggaaaatcttgtcatagttctcacccgcaaaatggtattaatgca
attgaagggctgttaaagtttatcgaagaagaaaaacacctttttgataacaccaaagat
gatcaataccttggaaaagtccaacatagtattacagttatcgatggtggatctcaagtt
aataccatccccgacagtgctagtttgcaaggaaatatccgccctacggcatcatttaat
aatgttaaagtcgcagatcgattaaatgatgcgcttgaatatattaaccacacaactcct
ttccaactagagctggtggattatagaatgaagttagccacccagttggtggtaaataaa
aaacgccattcggcgtga

DBGET integrated database retrieval system