KEGG   Lactobacillus reuteri SD2112: HMPREF0538_21365Help
Entry
HMPREF0538_21365  CDS       T01551                                 

Definition
(GenBank) peptidase dimerization domain protein
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
lru  Lactobacillus reuteri SD2112
Pathway
lru00300  Lysine biosynthesis
lru01100  Metabolic pathways
lru01120  Microbial metabolism in diverse environments
lru01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:lru00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    HMPREF0538_21365
Enzymes [BR:lru01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     HMPREF0538_21365
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28
Motif
Other DBs
NCBI-ProteinID: AEI57575
UniProt: F8DS23
Position
complement(1375131..1376048)
Genome map
AA seq 305 aa AA seqDB search
MEVSEKVKVLQDLIKIHSVNGNEVEVARYLQKLLANHGIDSKVDEFGDRRANLIAEIGTG
ESKKILGLTGHQDTVAVPNPDRWQHDPFGGEISGDYIFGRGAADMKSGLAAQAIVLIELK
EAGQLPSGTVRFIATAGEELGTPGAYRLQKQGVADDLDALVVGEPTGGNVIFAHSGSMNY
RVTSYGKSCHSSHPQNGINAIEGLLKFIEEEKHLFDNTKDDQYLGKVQHSITVIDGGSQV
NTIPDSASLQGNIRPTASFNNVKVADRLNDALEYINHTTPFQLELVDYRMKLATQLVVNK
KRHSA
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atggaggtcagtgaaaaagtcaaagtactgcaggatttaataaaaatccattctgttaat
ggaaatgaagttgaagtagcacgctacttacaaaaacttttagcaaatcacggaatcgat
tcaaaagttgatgaatttggtgatcgccgtgcaaacttgattgcggaaattgggactggg
gaaagtaaaaaaatccttgggctcactggacaccaagacactgtggcagtacctaatcca
gaccgctggcaacatgatccctttggcggtgaaattagtggtgattatatttttggtcgt
ggagctgctgacatgaagagcggtctggctgcccaggctattgtattaatcgaattaaaa
gaagctgggcaactgccatcaggaactgttagatttattgctaccgccggagaagaactt
ggtactcctggagcttatcgtttacaaaagcaaggagttgccgatgaccttgacgcatta
gtagtcggcgaaccaaccggtgggaatgttatttttgctcactcggggagtatgaattac
cgcgttaccagttatggaaaatcttgtcatagttctcacccgcaaaatggtattaatgca
attgaagggctgttaaagtttatcgaagaagaaaaacacctttttgataacaccaaagat
gatcaataccttggaaaagtccaacatagtattacagttatcgatggtggatctcaagtt
aataccatccccgacagtgctagtttgcaaggaaatatccgccctacggcatcatttaat
aatgttaaagtcgcagatcgattaaatgatgcgcttgaatatattaaccacacaactcct
ttccaactagagctggtggattatagaatgaagttagccacccagttggtggtaaataaa
aaacgccattcggcgtga

DBGET integrated database retrieval system