KEGG   Lactobacillus reuteri SD2112: HMPREF0538_21392Help
Entry
HMPREF0538_21392  CDS       T01551                                 

Gene name
ispE
Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (EC:2.7.1.148)
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
lru  Lactobacillus reuteri SD2112
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lru00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    HMPREF0538_21392 (ispE)
Enzymes [BR:lru01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     HMPREF0538_21392 (ispE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1404278..1405129
Genome map
AA seq 283 aa AA seqDB search
MIVTEKAPAKLNLSLDTPMRYFDGSPRWDMVMVSADLADYVTVETHRRPATIKVYTNSGF
LPNDQRNLAYQAAHILRSRFHCKDGVTIRIKKQIPVAAGLGGGSSDAAAVLRALNSIWRL
GLSLSELAKIALTIDSDVPYCIYNKLAHVTGHGEKIELLPPQPHYWAVIAKQKISVSTPQ
ILRQINYEKLQHLNNEALLTNLKKEDWQEATKYMGNVLEPLTMKFYPEIGRLKNKMKELG
ADVAQMSGTGPTVFAICHTESRAKRIQNSIRGFCRDVHVVTLL
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atgatagttacagaaaaagcaccagcaaaattgaatttgagtttagatacgccgatgcga
tattttgatggttctcctcgatgggatatggtaatggtctcggcagacctggctgattat
gtaactgttgagacacaccggcgccctgcaacaattaaagtctatacaaatagtggcttt
ttacccaatgaccaacgtaatttagcataccaagcagctcatattttacgtagtcgtttt
cattgtaaagatggcgttacaattcggattaagaagcaaattccagtcgcggccggattg
ggcggtggctcttcagatgcagcggcagttttacgcgcattaaatagtatttggcggttg
ggcttgagtttatcagaactagcaaagatcgcattaacaattgattctgacgtcccgtat
tgtatatataacaaattagcccacgttactggccatggtgaaaaaatcgaattgttacca
ccgcaacctcattattgggctgtaattgcaaaacagaagatcagtgtttctacgccgcaa
atcttacgacaaattaattatgagaagcttcaacatcttaataatgaagcattactgaca
aatttaaagaaagaggattggcaagaagcaacaaaatatatgggaaatgttttagagccc
ttaacgatgaaattttatccagagattggtcgtctaaagaataagatgaaagaattgggg
gccgatgttgcccagatgagtgggacgggaccaaccgtcttcgcaatctgccatacagaa
tcgcgagcaaaacggattcaaaatagtatccggggattttgtcgcgacgttcatgttgta
actttgctttga

DBGET integrated database retrieval system