KEGG   Lactobacillus reuteri SD2112: HMPREF0538_21411Help
Entry
HMPREF0538_21411  CDS       T01551                                 

Gene name
murAB
Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase 2 (EC:2.5.1.7)
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
lru  Lactobacillus reuteri SD2112
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lru00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    HMPREF0538_21411 (murAB)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    HMPREF0538_21411 (murAB)
Enzymes [BR:lru01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     HMPREF0538_21411 (murAB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1421824..1423101
Genome map
AA seq 425 aa AA seqDB search
MKKMIIQGGNRLSGEVTIGGAKNSTVALIPAAILADTPVEFDTVPDILDVHNLMIILESM
NVKSEFSHGVLDIDPTQIVEAELPSKAIKSLRASYYFMGALLGRFHRATLTFPGGDNIGP
RPIDQHLKAFKALGATVSEEKGTVHLDAPNGLHGSRIFLDMVSVGATINATLAAVRAEGT
TIIENAAREPEIIDLATFLNNMGAKIRGAGTDTIRITGVKTLQSMNTHTIIADRIEAGTY
LSLAAALGDGVMIHNVIPEHLESFTSKMIEMGVELQIDSDKIYVPKSSHLHPVTVKTMPF
PGFATDLQQPLTPLMSLADGDSTIVDTIYPKRVKHISQLQKMGMKIEAHDGMIIVKHTEK
LHGAEVSAGEIRAGAALTIAGLMADGQTVINNAGNILRGYDRIVWKLNRLHANVSIEDDS
SVKIG
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaaatgatcattcaaggaggaaaccgtctttctggcgaagttacgatcggtggt
gccaaaaatagtacagtggcattaattccagctgctattcttgcggatacccctgtagag
tttgacacggttccagatatcttggatgttcacaatctgatgattattttggagtcaatg
aatgtaaagtccgagtttagtcacggagttttagatattgatccaacacaaatcgtagaa
gctgaacttccaagcaaggcaattaaaagtcttcgggcttcctattactttatgggtgca
ttattaggtcgtttccatcgcgcgacattaacatttccgggaggcgataatatcggccct
cgcccaattgaccaacatttaaaagcatttaaagcacttggagcaaccgttagcgaagaa
aagggtactgttcatttagatgcgccgaatggcttacatgggtctcggatctttttagat
atggtatcagttggtgcaacgattaatgctaccttagcagctgttcgcgctgaaggaaca
acgattattgaaaatgcagctcgtgagccggaaattattgatttggcaacattcttaaat
aatatgggcgccaaaattcggggtgctggaaccgatactatccgtatcactggagtaaaa
acacttcagtcaatgaatactcatacaattattgctgatcgaattgaagcaggaacatac
ctatccttggcagcagcgcttggtgatggggttatgatccataatgttattcctgaacac
ttagaatcatttaccagtaaaatgattgaaatgggtgttgaacttcaaatcgatagcgat
aagatttatgtaccaaaatccagtcatttacatccggttactgttaagacaatgccattc
cctggttttgctactgatttacaacaaccgcttaccccattgatgtctcttgctgatggt
gatagtacgattgttgataccatttatcccaagcgtgtaaagcacatttcccaactacaa
aaaatggggatgaagattgaagcacatgatgggatgattatcgttaaacatacagaaaag
cttcatggcgcagaagtctctgcaggtgagattcgtgccggagcagctttaaccattgct
ggattaatggcagatggacagactgtaattaataatgccggaaatattttacggggttac
gatcgaattgtatggaagcttaatcgccttcatgccaatgtttctattgaggacgattct
tcagtaaaaattggttag

DBGET integrated database retrieval system