KEGG   Lactobacillus reuteri SD2112: HMPREF0538_21418Help
Entry
HMPREF0538_21418  CDS       T01551                                 

Gene name
tpiA2
Definition
triose-phosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
lru  Lactobacillus reuteri SD2112
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Class
Metabolism; Overview; Carbon metabolism [PATH:lru01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:lru01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:lru00010]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:lru00051]
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:lru00562]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1431158..1431937
Genome map
AA seq 259 aa AA seqDB search
MRKPFIIANWKMNKNVHESVAFVKAIKEKLPANKEIGIAAQAVSLYNMKKVAGSSNLQII
AQNASAELEGPYTGEISMRSLADAGVTYVMLGHLERRRLFNENNDSINQKVLAALNAGII
PIICTDEEMVQTEVNGQIHYVFRQLKSVLKGVPANKLSQIVISYEPSWAVGSTHQANPDI
AEEGCLAIRQSLVEMYGNEIGEQVRILYGGSVNPENIGQIMSKPNVDGALIGRASLEIES
FLQMINYIELASKQKLQVI
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgcgcaaaccgtttattattgcgaactggaaaatgaataaaaatgttcatgaatccgtt
gcgtttgttaaagcaattaaagaaaaactcccggcaaataaagaaattgggatcgcggca
caagcagtctcgctctataacatgaaaaaagtggcgggatcttccaacttacaaattatt
gctcaaaatgcatctgctgagttagagggaccgtatactggagaaattagcatgcgaagt
ttagcagatgcgggcgtgacatacgtgatgctagggcatttagagcgccggcgccttttt
aacgagaataatgattcaattaatcaaaaagttttagcagccctcaatgctggtattatt
ccaatcatttgtacggatgaagagatggtccaaacagaagttaacggacaaattcattat
gtatttcgccaactaaaaagcgtccttaagggggtaccagctaataaactatcacagatt
gttatttcgtatgaaccaagttgggccgttgggagcacgcatcaagcaaatccagacatt
gcggaagagggatgtctggcaattcgtcaaagtctagttgaaatgtatggtaatgagatt
ggcgagcaagtccgaatactctatggtggcagtgttaatcccgagaatattggtcaaatt
atgagtaaaccaaatgttgatggggcgctaattggtcgcgcaagtctcgagattgaaagc
ttcttacaaatgattaattatatcgaattagcgagcaagcagaagttacaggtaatttag

DBGET integrated database retrieval system