KEGG   Lactobacillus reuteri SD2112: HMPREF0538_21418Help
Entry
HMPREF0538_21418  CDS       T01551                                 

Gene name
tpiA
Definition
(GenBank) triose-phosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
lru  Lactobacillus reuteri SD2112
Pathway
lru00010  Glycolysis / Gluconeogenesis
lru00051  Fructose and mannose metabolism
lru00562  Inositol phosphate metabolism
lru01100  Metabolic pathways
lru01110  Biosynthesis of secondary metabolites
lru01120  Microbial metabolism in diverse environments
lru01130  Biosynthesis of antibiotics
lru01200  Carbon metabolism
lru01230  Biosynthesis of amino acids
Module
lru_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:lru00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HMPREF0538_21418 (tpiA)
   00051 Fructose and mannose metabolism
    HMPREF0538_21418 (tpiA)
   00562 Inositol phosphate metabolism
    HMPREF0538_21418 (tpiA)
Enzymes [BR:lru01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     HMPREF0538_21418 (tpiA)
Exosome [BR:lru04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   HMPREF0538_21418 (tpiA)
  Exosomal proteins of bladder cancer cells
   HMPREF0538_21418 (tpiA)
  Exosomal proteins of melanoma cells
   HMPREF0538_21418 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: AEI57628
UniProt: F8DL09
Position
1431158..1431937
Genome map
AA seq 259 aa AA seqDB search
MRKPFIIANWKMNKNVHESVAFVKAIKEKLPANKEIGIAAQAVSLYNMKKVAGSSNLQII
AQNASAELEGPYTGEISMRSLADAGVTYVMLGHLERRRLFNENNDSINQKVLAALNAGII
PIICTDEEMVQTEVNGQIHYVFRQLKSVLKGVPANKLSQIVISYEPSWAVGSTHQANPDI
AEEGCLAIRQSLVEMYGNEIGEQVRILYGGSVNPENIGQIMSKPNVDGALIGRASLEIES
FLQMINYIELASKQKLQVI
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgcgcaaaccgtttattattgcgaactggaaaatgaataaaaatgttcatgaatccgtt
gcgtttgttaaagcaattaaagaaaaactcccggcaaataaagaaattgggatcgcggca
caagcagtctcgctctataacatgaaaaaagtggcgggatcttccaacttacaaattatt
gctcaaaatgcatctgctgagttagagggaccgtatactggagaaattagcatgcgaagt
ttagcagatgcgggcgtgacatacgtgatgctagggcatttagagcgccggcgccttttt
aacgagaataatgattcaattaatcaaaaagttttagcagccctcaatgctggtattatt
ccaatcatttgtacggatgaagagatggtccaaacagaagttaacggacaaattcattat
gtatttcgccaactaaaaagcgtccttaagggggtaccagctaataaactatcacagatt
gttatttcgtatgaaccaagttgggccgttgggagcacgcatcaagcaaatccagacatt
gcggaagagggatgtctggcaattcgtcaaagtctagttgaaatgtatggtaatgagatt
ggcgagcaagtccgaatactctatggtggcagtgttaatcccgagaatattggtcaaatt
atgagtaaaccaaatgttgatggggcgctaattggtcgcgcaagtctcgagattgaaagc
ttcttacaaatgattaattatatcgaattagcgagcaagcagaagttacaggtaatttag

DBGET integrated database retrieval system