KEGG   Lactobacillus reuteri SD2112: HMPREF0538_21496Help
Entry
HMPREF0538_21496  CDS       T01551                                 

Gene name
gpm3
Definition
phosphoglycerate mutase (EC:5.4.2.1)
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
lru  Lactobacillus reuteri SD2112
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:lru00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HMPREF0538_21496 (gpm3)
   01230 Biosynthesis of amino acids
    HMPREF0538_21496 (gpm3)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HMPREF0538_21496 (gpm3)
  Energy metabolism
   00680 Methane metabolism
    HMPREF0538_21496 (gpm3)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HMPREF0538_21496 (gpm3)
Enzymes [BR:lru01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     HMPREF0538_21496 (gpm3)
Exosome [BR:lru04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   HMPREF0538_21496 (gpm3)
  Exosomal proteins of melanoma cells
   HMPREF0538_21496 (gpm3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1521183..1521932
Genome map
AA seq 249 aa AA seqDB search
MRYYKIVAKGSEKMAELVIVRHGQSQANRDNIFTGWTDVPLTPKGIEQGELVGKELLRLG
IQFSDAYTSYMERAIMTTNIILEEINQLYIPVHKTWRLNERHYGALSGRNKDEVKKEIGA
EQLHKWRRGFKDLPPQLKERQHDRRYDRLGVKIPLSESLEMTLQRLLPYWQDHIAPRLID
GHNQLIVAHGSSLRALIKYLDGISDNDIDKVEVPNGKPILYRFGDHLNVIKKTFITMDGE
IDDNTRISK
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgcgctattataagatagtggcaaaggggagtgaaaaaatggcagaattagtaattgta
cgtcatgggcaaagtcaagctaaccgtgataatatttttactggctggactgatgttccg
ttgactcctaaaggaattgaacagggtgaattagtcggcaaggaattgctaagactgggt
atccaatttagtgatgcatatacgtcttacatggaacgggcaatcatgacgactaatatt
atcctagaagaaattaatcagttatatattcctgtccataaaacgtggcgactaaacgaa
cgtcattatggggcattgagtggccggaacaaagatgaagtgaagaaagagattggtgca
gaacagcttcataaatggcggcgtggttttaaagatttgccaccacaattaaaagagcgt
cagcatgatcgccgctatgatcgcttaggagttaagattccgcttagtgagagtttagaa
atgacgctccaacgactcctcccatattggcaagaccatattgcgcctcgtttgattgat
ggacataatcagttaattgttgcccatggtagttctttgcgggcactaattaaatattta
gatggtatttcagataacgatattgataaagtggaagttccaaatggcaagccaatttta
tatcgctttggtgatcaccttaatgtcattaaaaagacttttataacaatggatggtgaa
attgatgacaatacacgaattagcaaataa

DBGET integrated database retrieval system