KEGG   Lactobacillus reuteri SD2112: HMPREF0538_21527Help
Entry
HMPREF0538_21527  CDS       T01551                                 

Gene name
aad
Definition
aldehyde-alcohol dehydrogenase (EC:1.1.1.1 1.2.1.10)
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
lru  Lactobacillus reuteri SD2112
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:lru00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    HMPREF0538_21527 (aad)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HMPREF0538_21527 (aad)
   00620 Pyruvate metabolism
    HMPREF0538_21527 (aad)
   00650 Butanoate metabolism
    HMPREF0538_21527 (aad)
  Lipid metabolism
   00071 Fatty acid degradation
    HMPREF0538_21527 (aad)
  Amino acid metabolism
   00350 Tyrosine metabolism
    HMPREF0538_21527 (aad)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    HMPREF0538_21527 (aad)
   00626 Naphthalene degradation
    HMPREF0538_21527 (aad)
Enzymes [BR:lru01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     HMPREF0538_21527 (aad)
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     HMPREF0538_21527 (aad)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1546008..1548644)
Genome map
AA seq 878 aa AA seqDB search
MPANNKKQVEKNVLTEEEKKQNAQKLVNDIIAKSEAAFEQLRYYSQEQVDKICQAMALAA
EEHHMDLAIDAAEETGRGVAEDKAIKNIYASEYIWNNIRHDKTVGIIEDNDENQTITIAD
PLGIIAGIVPVTNPTSTTIFKSIISAKTRNTIIFSFHRQAMKSSIKTAKILQEAAEKAGA
PKNMIQWLPESSRENTSALLQHPKTATILATGGPSLVKAAYSSGNPALGVGPGNGPAYIE
KTANIERSVYDIVLSKTFDNGMICATENSVVVDEEIYDKVKEEFQKWNCYFLKPNEIDKF
TEGFIDPKRHQVRGPIAGRSANAIADMCGIKVPENTKVIIAEYEGVGDKYPLSAEKLSPV
LTMYKATSHENAFDICAQLLHYGGEGHTAAIHTLDDDLATKYGLEMRASRIIVNSPSGIG
GIGNIYNNMTPSLTLGTGSYGGNSISHNVTDWDLLNIKTIAKRRENRQWVKIPPKVYFQR
NSLKELQDIPNINRAFIVTGPGMSKRGYVQRVIDQLRQRQNNTAFLVFDDVEEDPSTNTV
EKGVAMMNDFKPDTIIALGGGSPMDAAKAMWMFYEHPETSWYGVMQKYLDIRKRAYQIKK
PTKSQLIGIPTTSGTGSEVTPFAVITDSETHVKYPLADYALTPNIAIVDSQFVETVPAKT
TAWTGLDVLCHATESYVSVMATDYTRGWSLQTIKGVMENLPKSVQGDKLARRKMHDFSTM
AGMAFGQAFLGINHSLAHKMGGAFGLPHGLLIAIAMPQVIRFNAKRPQKLALWPHYETYH
ATKDYADIARFIGLKGNTDEELAEAYAKKVIELAHECGVKLSLKDNGVTREEFDKVVDDL
ARLAYEDQCTTTNPVEPLVSQLKELLERCYDGTGVEEK
NT seq 2637 nt NT seq  +upstreamnt  +downstreamnt
atgcctgctaacaacaaaaaacaagttgaaaaaaacgtattaactgaagaagaaaaaaag
caaaatgcgcaaaaattagttaatgacataattgccaaaagtgaagcagcttttgaacaa
ttacgttactactcacaagaacaagttgataaaatttgtcaagccatggccttagctgct
gaagaacaccacatggacttagctattgatgcagctgaagaaactggtcgtggagttgcc
gaagataaggctatcaagaacatctacgcaagtgaatacatttggaacaacatccgtcat
gataagactgtcggaatcatcgaagacaacgatgaaaaccaaaccatcactattgctgat
ccgcttggtattattgcaggtatcgttccagttactaaccctacttcaacaacgatcttc
aaatcaatcattagtgctaagacgcggaatacaattatcttctcattccaccgtcaagcc
atgaaatcttccattaaaacagctaagattttacaagaagctgcggaaaaggccggtgca
ccaaagaacatgattcagtggcttcctgaaagtagccgtgaaaatacaagtgcattgtta
caacaccctaagactgctactattttagcaactggtggtccttcattagttaaggctgcc
tacagttcaggtaaccctgctcttggtgttggtcctggtaacggtccagcttacattgaa
aagactgctaatattgaacgttctgtttacgatatcgttctttctaagacttttgataac
ggaatgatctgtgctactgaaaactcagttgttgttgatgaagaaatctacgacaaggta
aaagaagaattccaaaaatggaactgttacttcttgaagccaaatgaaattgataagttc
actgaaggcttcattgatcctaagcgtcaccaagttcgtggaccaattgctggtcgttca
gctaacgccatcgctgatatgtgtggaattaaagttcctgaaaacactaaggttatcatc
gctgaatatgaaggggttggtgacaagtacccactttcagctgaaaagctttcaccagta
ttaacaatgtataaggccacttcacatgaaaatgcctttgatatctgtgctcaattatta
cactacggtggtgaaggtcacactgctgctattcacacccttgatgatgatttagcaact
aagtacggtcttgaaatgcgtgcttcacggatcattgttaactctccatctggtatcggt
ggtattggtaacatttacaataacatgacaccatcacttactttaggtaccggttcatac
ggtggtaactcaatttctcacaacgttactgattgggatctcttaaacatcaaaacaatt
gcaaagcggcgtgaaaaccgtcaatgggttaagattcccccaaaagtatactttcaacgc
aactcactaaaagaattgcaagatattccaaacattaaccgagcatttatcgttactggt
cctggaatgagcaagcgtggttacgttcaacgtgttatcgatcaattgcgtcaacgtcaa
aacaacactgctttcttagtatttgatgacgttgaagaagatccatcaacaaacactgtt
gaaaaaggtgttgccatgatgaacgacttcaaacctgatacaattattgctcttggtggt
ggttcaccaatggatgctgctaaggctatgtggatgttctatgagcatccagaaacttca
tggtatggggttatgcaaaagtatcttgatattcggaagcgtgcttaccaaatcaagaag
cctactaagtctcaacttattgggattcctactacatcaggtactggttcagaggttact
ccatttgcggttattaccgattcagaaactcatgttaagtacccacttgctgactacgcc
ttaactccaaacattgcgattgttgactcacaattcgttgaaactgtcccagcaaaaact
actgcatggactggactagatgttttatgtcacgctactgaatcatatgtttcagttatg
gcaactgattacactcgtggttggtcactacaaaccatcaagggtgttatggaaaacctt
cctaagtcagttcaaggtgacaagttagctcgtcgtaagatgcacgacttctcaacaatg
gccggtatggcatttggtcaagccttcttaggaattaatcactctcttgcccacaagatg
ggtggagcattcggtcttcctcacggtttgcttatcgctattgcaatgccacaagtaatt
cgctttaacgcaaaacgtccacaaaagcttgctctctggcctcactatgagacttaccat
gcaactaaggactacgctgacattgcacggttcattggtttgaaaggcaacactgatgaa
gaattagctgaagcatatgctaagaaagttatcgaacttgctcacgaatgtggtgttaag
cttagtcttaaggacaatggcgttacacgtgaagaatttgataaagtagttgacgatctt
gctcgcttagcttacgaagatcaatgtactactactaacccagttgaaccacttgttagc
caactcaaggaattacttgaacgttgctacgatggtactggcgttgaagaaaaataa

DBGET integrated database retrieval system