KEGG   Lactobacillus reuteri SD2112: HMPREF0538_21553Help
Entry
HMPREF0538_21553  CDS       T01551                                 

Gene name
proB
Definition
glutamate 5-kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
lru  Lactobacillus reuteri SD2112
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:lru01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:lru00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1573199..1573987)
Genome map
AA seq 262 aa AA seqDB search
MTHKIQKVVVKIGTSSLVLPNGKINLRTIDQLSFVLATLNNQGYQLILVSSGAIGVGLAS
LGLTDRPAEIAQQQALASIGQAALMRIYSQRFLDYQTHVAQLLLTRDVLTYPVSRQHTLN
TINALLQQNVIPIVNENDPVSVDELDHYTTFSDNDELSSQVAIAIDADELIILSDIDALY
DKDPHKFPDAQIIKEVPFLTPEIENVASGSSTRFGTGGMVTKLRAAATMMQAGKQMILCN
GRDPKILFDIFDGHTIGTHFGK
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgactcataaaatacaaaaagtagttgttaagattggtacgagtagccttgttcttcct
aatggaaaaattaatttacgaacaatcgaccaactttcatttgtccttgcgacattaaac
aatcaaggataccaacttattcttgtttcctcgggagcaattggcgttggtcttgcaagt
ttgggattaacagatcgtcccgccgaaatagcacaacagcaagccttagcatctatcggt
caggctgctttaatgcgaatctattcgcaacgatttttagactatcaaacgcacgtcgcc
caacttctccttacccgtgatgtgctcacttatcccgtcagtcgccagcatacgcttaat
acaattaatgctttacttcagcaaaatgtgattccaatcgttaacgaaaatgaccccgtg
tcagttgatgagcttgatcattacactactttcagtgacaatgatgaactctcttcccag
gtagctattgccattgatgctgacgagctaatcattctttcggatatcgatgccctttat
gacaaagatccgcataaatttcctgacgcacaaatcattaaagaagttccattcctaacg
ccggaaatagagaacgtcgcaagcggtagcagcactaggtttggaacaggaggaatggta
actaaattacgggcagctgccacaatgatgcaagcaggtaaacaaatgattttatgcaat
ggtcgtgaccctaaaattctttttgatatttttgatggtcatactattggtactcatttt
ggaaaatag

DBGET integrated database retrieval system