KEGG   Lactobacillus reuteri SD2112: HMPREF0538_21608Help
Entry
HMPREF0538_21608  CDS       T01551                                 

Gene name
tpiA3
Definition
triose-phosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
lru  Lactobacillus reuteri SD2112
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:lru00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HMPREF0538_21608 (tpiA3)
   01230 Biosynthesis of amino acids
    HMPREF0538_21608 (tpiA3)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HMPREF0538_21608 (tpiA3)
   00051 Fructose and mannose metabolism
    HMPREF0538_21608 (tpiA3)
   00562 Inositol phosphate metabolism
    HMPREF0538_21608 (tpiA3)
Enzymes [BR:lru01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     HMPREF0538_21608 (tpiA3)
Exosome [BR:lru04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   HMPREF0538_21608 (tpiA3)
  Exosomal proteins of bladder cancer cells
   HMPREF0538_21608 (tpiA3)
  Exosomal proteins of melanoma cells
   HMPREF0538_21608 (tpiA3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1629107..1629856
Genome map
AA seq 249 aa AA seqDB search
MRVPIIAGNWKMHKDVQEAVSFIEKIKNQLPPADQLETAIAAPTLCLVPMVKAAKESPLK
IMAENCYYKNEGAYTGETSPYALYQAGIHHVILGHSERRTYFNETDELINKKVKAALVNG
LCPIVCCDDTMRRRVAGKKVHWVVSRILADLHGLTNDEICHVTVAYEPSWAIGTGESADP
EQAAEGCYLIRQTISDMYGDEVANNVRILYGGSVTTSNINALMAKNDIDGVLVGAASLNP
ETFLQLVHH
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgagagtaccgattattgctggcaattggaaaatgcataaggatgtacaagaagctgtc
tcttttatcgaaaaaataaaaaatcagcttccacctgccgaccaacttgaaacagcaatt
gctgctcctactctttgtttggtaccaatggttaaagcggctaaagaatctccattaaaa
ataatggcagaaaactgctattataagaatgaaggagcctatactggtgaaacaagtcca
tatgctttataccaagcaggaatccatcatgtaattttaggacattctgaacgccgaact
tactttaatgaaactgatgaattaattaataaaaaagtgaaggcagcattagtaaacggg
ttatgtccgattgtttgttgtgatgatactatgcgtcgacgagttgctggaaagaaagtt
cattgggtggtgagccgaattctcgctgatcttcatggattgaccaatgacgaaatttgt
catgttacggttgcttatgaacctagttgggcgattggaacaggcgagagtgctgatcca
gaacaagcggcggaaggttgttaccttattcgccagacgattagtgatatgtatggcgat
gaagttgcaaataatgttcgaattctctatggaggaagtgtgacaacatctaatatcaat
gcactaatggcaaaaaatgatattgatggtgttttagtcggagcggcgagcttaaatcca
gaaacatttttacaattagttcaccattag

DBGET integrated database retrieval system