KEGG   Lactobacillus reuteri SD2112: HMPREF0538_21613Help
Entry
HMPREF0538_21613  CDS       T01551                                 

Gene name
est
Definition
lipase/esterase Est (EC:3.1.1.1)
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
lru  Lactobacillus reuteri SD2112
Brite
Enzymes [BR:lru01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     HMPREF0538_21613 (est)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1634961..1635677
Genome map
AA seq 238 aa AA seqDB search
MLHAYTGNTNDVRMLGRQLNWQGYTVFAPLLHGHGGDPQKVLESNGPDDWWDDTRMAIFR
LRDAGVDQIAIFGLSLGGLLATRALENDPQLLGGGVFASPITTWGQSNVPEYFPKIAAKY
YRQQKINPLITKEKVAKLTERLPQQLAQIQTMAHQICDQLDQIHQPFFIAQGGADEMIDP
ASGLQLKTKLQENGVAVDYHYYPTATHLLTVNTAHRQLFADVEKYLQNLFEVSSNDNK
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
ttgcttcatgcatatacaggaaatacgaatgatgttcgaatgctgggacgtcagcttaac
tggcaaggatatacggttttcgcaccgcttttgcatggtcatggtggtgatccgcaaaag
gtgctggaaagcaatggcccagatgattggtgggatgatacccggatggcaatttttcgt
ttacgagatgccggagttgatcaaattgcaatttttgggttatcgcttggtggtttactt
gcaacaagagctcttgagaatgatccgcaattattaggtggtggtgtttttgcatcccca
attaccacctggggacaatcgaatgttccggaatacttccctaaaattgcggcaaagtat
tatcgtcagcaaaaaatcaacccattaattactaaggaaaaggttgctaaattgactgaa
cgactcccccaacaactagcacaaattcaaacaatggcgcatcaaatttgtgaccaatta
gatcagattcatcagccattctttattgcacaaggaggcgcagatgaaatgattgatcca
gcgtctggactgcaattaaaaacaaaattacaggagaatggggttgcagttgattaccat
tactacccaaccgctactcacttattaacagttaataccgctcatcgtcaactatttgcc
gatgtagaaaaatatttacaaaatttattcgaggtgtcttctaatgacaacaaataa

DBGET integrated database retrieval system