KEGG   Lactobacillus reuteri SD2112: HMPREF0538_21755Help
Entry
HMPREF0538_21755  CDS       T01551                                 

Gene name
ruvA
Definition
crossover junction ATP-dependent DNA helicase RuvA (EC:3.6.1.-)
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
lru  Lactobacillus reuteri SD2112
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:lru00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    HMPREF0538_21755 (ruvA)
Enzymes [BR:lru01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     HMPREF0538_21755 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1785152..1785751
Genome map
AA seq 199 aa AA seqDB search
MYEYLTGLVTVVAPQYIVVDVNGVGYKLLVANPYRYQEDRTKKVQVYVYQAVREDNISLF
GFTDQNEKKLFMQLINVSGIGPKSALAILANPDHQGLVDAITNNNVNYLTKFPGIGKKTA
SQIVLDLRDKLTNESSSSLFATTQLTVDATVNRELKDALEALAALGYKERDIKKVQKTLM
KEEQMATDEYLRQALRLLN
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
ttgtacgaatacttaacaggccttgtaactgttgttgcaccacaatatatcgttgttgat
gttaatggggttggctataaattattagttgctaatccctatcgttatcaagaggatcgg
actaagaaggtccaagtatatgtttatcaagcagttcgtgaagataatatttccttgttt
ggcttcacagatcaaaatgaaaaaaaactatttatgcaattaatcaatgtttctggaatt
gggccaaagagtgctttagcaattttagcgaaccctgatcatcagggacttgttgatgca
attactaataataatgttaactatttaactaagttcccaggaatcgggaaaaagacagct
tcgcaaattgtgttagacttacgtgataagctcactaatgaaagcagcagctcattattt
gcaacaactcagcttaccgttgatgcaacagtaaatcgtgagttgaaagatgctttggaa
gcattggctgcattaggatacaaggaacgggacattaaaaaggttcaaaagacattaatg
aaagaagaacaaatggcaactgatgaatacttaagacaagcattaaggttgcttaactag

DBGET integrated database retrieval system