KEGG   Lactobacillus reuteri SD2112: HMPREF0538_21851Help
Entry
HMPREF0538_21851  CDS       T01551                                 

Gene name
recD
Definition
exodeoxyribonuclease V subunit alpha (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
lru  Lactobacillus reuteri SD2112
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:lru00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    HMPREF0538_21851 (recD)
Enzymes [BR:lru01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     HMPREF0538_21851 (recD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1884123..1886600
Genome map
AA seq 825 aa AA seqDB search
MAEEIDLFKTPTEPSFFIGQVQSEIFTSPDSFFKVLIVSVEEANFDWHEPEITVTGSFGD
LSDNQTYRFEGKIVEHPRYGQQFQATSYHVNRPTSKDGLVDFLSGKQFTGIGKKTAEKII
DKLGTDAINKIIADPHVLDKLKLRKAVKDSLVDNLRANQGMDEIIIGLNDLGFGANLSSA
IFDKYGEETLHIINENPYQLAAEIDGISFNRADQVAQKLGIATDDSRRIDAAIIQMLDDL
TMETGDTFTTTKPLLQQTIQLLAQGSGGRVSTDLIANQIIELEKNQAISYADEKIYPTAL
YNAEWQIADHLHRLLTVDQEKVPVTTIEKTVTKVADQSGITYDQVQKEAIKTALNSKVML
LTGGPGTGKTTIIKGIVASYAKIHDLSLDVNEYKEKSFPVLLAAPTGRAAKRMSEATDLP
ASTIHRLLGLNGREMPTDMNARDLEGSLLIIDEMSMVDTLLFKTLIQAVPTSMHVVLVGD
KDQLPSVGPGQVFHDLLDFAELPKVELTNIHRQAADSTIIPLAHAIKEGKLPSDLTNKMP
DRSFISCHANQVPSVVQQIIDLSKKRDYSANDIQILAPMYRGQAGIDRLNELAQQAYNPP
ANGKQEVDFRGLTFRVGDKVLQLVNVPEKNIFNGDIGKITAIESGRTVGKKNESITVDFD
GNEVSYSRMEWNQLRLAYCISIHKAQGSQFKMVLLPIVQQFSRMLQRNLLYTAITRAAEK
LVLIGEPYAVVTSVKNEAVNRKTSLVDRLDKVWSKHGELKSKLDHQTDSLTKELSSPQPV
QKENKQLINNDAQQYILTADLINSETIDPLIGMENISLQSLHQAK
NT seq 2478 nt NT seq  +upstreamnt  +downstreamnt
atggctgaagaaatcgacctatttaagacgccaacggagccgtctttttttattggtcag
gtacaatctgagatttttactagtccagattcgttttttaaagttttaattgtctcggtt
gaagaagcaaattttgattggcacgagccggaaattactgtaaccggaagttttggtgat
cttagtgataatcagacttaccgctttgagggaaaaattgttgagcatccacgatatgga
caacaatttcaagctacttcttatcatgtcaaccgtcctacaagcaaggatgggttagtt
gatttcttgtctggaaaacaatttaccggaattggaaaaaagacggctgaaaaaattatc
gacaagttaggaacagatgcgattaataaaattattgctgacccgcatgttttagataaa
ttaaaactccgcaaagcagttaaggattcattagttgataatttacgggcaaaccagggg
atggacgagattattatcggcctaaatgatctcggctttggcgctaaccttagtagtgca
atttttgacaagtacggggaagaaactctacatattattaatgaaaacccctatcaactc
gccgctgaaatagatggaattagttttaatcgtgctgatcaggtggcacaaaaattagga
attgccacggatgattcacgccggattgatgcagcaattatccagatgcttgatgacttg
acaatggaaactggtgatacatttactacaaccaaacctcttctgcagcaaactatccag
ttgcttgcccaaggaagtggtggccgtgtttctacagatttaattgccaaccaaattatt
gagctagagaaaaatcaagcaattagttatgcggatgaaaaaatttatccaactgccctt
tataacgcggaatggcaaattgctgatcacttacatcgtcttcttaccgttgaccaggaa
aaagtaccagtaacgactattgaaaaaacagttacgaaggttgccgatcaatcagggata
acctatgaccaagttcaaaaagaagccatcaaaacagccttaaatagtaaagttatgctt
cttacgggaggcccaggaacgggaaaaacaacaattattaaagggattgtagcaagttat
gcgaaaattcatgatctttcattggacgtaaatgaatataaagaaaagtcatttcctgtt
ttactagctgctcctacaggccgagctgctaaacgaatgagtgaagctacagatttgcca
gcaagtacaatccaccgcttgctaggacttaacggtcgggaaatgccaactgatatgaat
gcccgcgatttagaaggctcgttattgattattgatgaaatgtcgatggtcgataccctc
ttgtttaagactcttattcaagccgtccctacttctatgcatgtggttttggtaggtgat
aaagaccaattaccatctgttggtcccgggcaagttttccatgatcttcttgactttgca
gaactgcccaaagttgaactaaccaatattcaccgccaggctgctgattcaacaattatc
ccattagctcatgctatcaaagagggtaagttaccatcagatctaacgaataaaatgcca
gatcgatcatttatctcatgccatgctaaccaagtgccaagtgtggttcaacaaattatt
gacctttctaaaaaacgagattattccgcaaatgatattcaaatcttggcaccaatgtac
cgcggacaggcgggaatcgaccgtttgaatgaacttgcacaacaggcatataatcctcca
gctaatggaaagcaagaagtcgattttaggggactaacttttcgtgttggagataaggtt
ttgcaactcgttaatgttccagaaaagaacatttttaatggtgatattggaaaaatcaca
gcaattgaaagcggtaggacagtcggtaagaaaaatgaatcaattactgtcgattttgat
ggtaatgaagtgagctatagccgcatggaatggaatcaattacggttagcttattgtatt
tcgatccataaagcacagggaagtcagtttaagatggttcttttgccgattgttcagcag
tttagccggatgcttcaacgaaatcttttatatacggcgattacccgtgccgcagaaaag
ttagtcttgatcggtgagccgtatgcggttgtgactagtgtaaaaaatgaagcagttaac
cggaaaacttctttggtcgatcgtcttgataaggtttggagtaagcatggtgaactaaaa
tcaaaattggatcatcaaacggattcgttaaccaaagaactttctagtccgcaacctgtt
caaaaagaaaataaacagttaataaataatgatgctcagcaatatatcctaacagctgat
ctcattaattcagagacaattgatccattaatcggaatggaaaatattagcttacaaagt
ttgcatcaagccaaataa

DBGET integrated database retrieval system