KEGG   Lactobacillus reuteri SD2112: HMPREF0538_22027Help
Entry
HMPREF0538_22027  CDS       T01551                                 

Gene name
folA
Definition
dihydrofolate reductase (EC:1.5.1.3)
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
lru  Lactobacillus reuteri SD2112
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lru00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    HMPREF0538_22027 (folA)
   00670 One carbon pool by folate
    HMPREF0538_22027 (folA)
Enzymes [BR:lru01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     HMPREF0538_22027 (folA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2068933..2069421
Genome map
AA seq 162 aa AA seqDB search
MSELNLIWAEDLNGWIGKDNTIPWHVSADMKHFKTKTTGHPIIMGRKTFASLGNKPLPKR
ENIVLTSQNIDAEGVKVVHSLAALKEYLKANPNEYFVIGGATIYQQLLPMATKLTRTVIN
KQIVGDTKMPTIDYDRWHLVNHNNYEKDDQLICRFEEWELNV
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaactgaatttaatctgggcggaagatttgaatggttggattggcaaagataat
acaattccgtggcatgtttctgctgatatgaagcattttaagacaaaaactactggtcac
ccaattataatggggcgaaaaacttttgcttctcttggcaataaaccgttgcctaagcga
gaaaatattgtgcttaccagtcagaacatagatgctgaaggagtgaaagtcgttcattct
ttagctgcccttaaagaatatcttaaagcaaatccaaacgaatattttgtaatcggtggg
gcaacgatctatcagcaattactcccaatggcgacaaagctaacacgaacggtgataaat
aagcaaattgttggagatacaaaaatgccaacgatcgattatgaccgttggcacttagta
aaccacaataattatgaaaaagatgaccagctaatttgtcgttttgaagaatgggaacta
aacgtataa

DBGET integrated database retrieval system