KEGG   Lactobacillus reuteri SD2112: HMPREF0538_22027Help
Entry
HMPREF0538_22027  CDS       T01551                                 

Gene name
folA
Definition
dihydrofolate reductase (EC:1.5.1.3)
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
lru  Lactobacillus reuteri SD2112
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:lru00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:lru00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2068933..2069421
Genome map
AA seq 162 aa AA seqDB search
MSELNLIWAEDLNGWIGKDNTIPWHVSADMKHFKTKTTGHPIIMGRKTFASLGNKPLPKR
ENIVLTSQNIDAEGVKVVHSLAALKEYLKANPNEYFVIGGATIYQQLLPMATKLTRTVIN
KQIVGDTKMPTIDYDRWHLVNHNNYEKDDQLICRFEEWELNV
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaactgaatttaatctgggcggaagatttgaatggttggattggcaaagataat
acaattccgtggcatgtttctgctgatatgaagcattttaagacaaaaactactggtcac
ccaattataatggggcgaaaaacttttgcttctcttggcaataaaccgttgcctaagcga
gaaaatattgtgcttaccagtcagaacatagatgctgaaggagtgaaagtcgttcattct
ttagctgcccttaaagaatatcttaaagcaaatccaaacgaatattttgtaatcggtggg
gcaacgatctatcagcaattactcccaatggcgacaaagctaacacgaacggtgataaat
aagcaaattgttggagatacaaaaatgccaacgatcgattatgaccgttggcacttagta
aaccacaataattatgaaaaagatgaccagctaatttgtcgttttgaagaatgggaacta
aacgtataa

DBGET integrated database retrieval system