KEGG   Lactobacillus reuteri SD2112: HMPREF0538_22175Help
Entry
HMPREF0538_22175  CDS       T01551                                 

Gene name
aga
Definition
alpha-galactosidase (EC:3.2.1.22)
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
lru  Lactobacillus reuteri SD2112
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:lru00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:lru00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:lru00600]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2186914..2189103
Genome map
AA seq 729 aa AA seqDB search
MITFDEQQRVFHLKNKEISYLFSIEEGNILSHLYFGPAIRNYHGERRYPRVDRGFSGNLP
GSMDRTYSKDDLLQEYSGNNTGDYRVPAIIIKTENGSRLTDFRYKSYKILPGKPKLAGLP
ASYVKSDKEAETLEVTLVDETIGAQLILSYTIYNERPVITRNARLVNTSNQELRIEKIAS
MQLDLTKHDYDVISVPGQYALERQPERQELRRGITEFSSRRNSSSHHMNPFVALVDKNTD
EFQGNALGVLLVYSGNHQFTLEKDQIDQIRLITGINDYNFEWVLEPGKDFQTPEAIMGFS
QCGLNGMSQVFHKLLRDRVARGKYQYADRPIVINNWEATFFDFDDKKLDQIIDEAKPLGI
EMFVLDDGWFGHRNDDNSSLGDWFVNQDKLTGGLKRVADRTHEHCMKFGLWFEPEMISVD
SKLYKEHPDYALHEPNRGMTLSRNQLVLDFSRKEVVDNIYNQMCLILDKVPLDYIKWDFN
RNLTEVFSSAADAEHQGEVSHRYVLGLYDLMERLVTRYPNILFEGCSGGGGRFDAGILYY
MPQSWPSDDTDAVERLKIQYGTSLTYPISSMTAHVSVSPNQQTGRSTSFKMRGDVAMSGV
FGYELDLADLTEEDRQMVKEQIKFYKAHRHLIQYGDFIRLESPFDSNTVAWEFVSPDKSE
ALLFMFKQLHTNRFEINNTKMAGLDPTIDYHDEMTDKTYGGDELMNVGLFRDPTRTGDFT
SEVHYFKGK
NT seq 2190 nt NT seq  +upstreamnt  +downstreamnt
atgattacatttgatgaacaacaacgtgtttttcacttaaaaaataaagaaatttcctat
ttattttcaatagaagagggaaatatcctcagtcacctttattttggaccggcaattcgt
aactaccatggtgaacgccgatatccacgagttgatcgtggattttcagggaaccttcct
ggatcgatggaccgaacttactctaaagatgatttgttgcaggagtattcgggaaacaat
accggagactatcgtgtgcctgcaattattatcaaaacagaaaatggttcacgactgact
gatttccgttacaagtcttataagattttaccggggaagcccaaactagctgggttacct
gcatcttatgttaaaagtgataaagaagcagaaacattggaagttactttggttgatgaa
acaatcggtgcacaacttattctttcatacactatctataacgaacggccggttattaca
cggaatgcgcggttagtaaacacaagcaatcaagaattacgaattgaaaagattgcctca
atgcaactggatttaactaaacatgattatgacgttatctccgttccaggccaatacgct
cttgaacgacaacctgaacgacaagaattacgtcggggaataacagaattttctagccgt
cgaaattctagttctcatcatatgaatccatttgtggccttagttgacaagaacactgat
gaatttcagggaaatgctttgggagtgctccttgtctactcaggtaatcaccagtttacc
ttggaaaaagatcagatcgaccagattcgcttaataactggaattaatgattataacttt
gaatgggttcttgaaccgggaaaagattttcagacacctgaagcaatcatgggctttagt
cagtgtggcttaaatgggatgtcacaagtattccataagttattacgggaccgggttgct
cgcggtaagtatcaatatgcagaccgaccaattgttattaataactgggaagcgaccttc
tttgactttgatgataagaagttagaccaaattattgatgaagcaaagccgttgggaatt
gaaatgtttgttcttgatgacggctggtttggccaccggaatgatgataattcatcgctt
ggtgattggtttgttaaccaggataagcttactggtggattaaagcgggtagcagaccgg
acccacgagcattgcatgaaatttggtctctggtttgagccagaaatgatttcagttgac
tctaagttatataaggaacatccagactatgccttacatgaaccaaaccgtggaatgaca
ctttctcgtaatcaattagtgctagactttagtcgtaaagaagtcgttgataatatttac
aatcaaatgtgcttaattttagataaggtgccacttgactatattaaatgggacttcaac
cgtaatcttactgaggtcttctctagcgcagcggatgcagaacatcaaggagaagttagc
caccgttatgttttaggtttatatgacttaatggagcggttagttacccgttatcctaat
atcttgtttgaaggctgttctggcggtggtggccgctttgatgctggtattctttactac
atgccgcaaagttggccatcagatgatacagacgcggttgaacgtttaaagattcaatac
ggaacatctttaacttatccaatctcatctatgacggcacatgtatcggtttcacctaac
cagcaaactggccgttctaccagttttaagatgcggggcgatgttgccatgagtggggtc
tttggatatgaacttgacttagcagatttgactgaagaggatcggcaaatggtaaaggaa
cagatcaaattttataaggctcaccgccacttaattcaatatggtgactttattcgctta
gaaagtccttttgatagcaatacagtcgcctgggaatttgtcagtccggataagtcagaa
gcactgctatttatgtttaagcagttgcatactaaccgttttgaaattaataataccaag
atggcagggcttgatccaacaattgattatcatgatgaaatgactgataagacttatggt
ggagatgaattgatgaatgtcggtttgttccgtgacccgactcgtacgggggacttcact
tccgaagtgcattactttaaaggtaaataa

DBGET integrated database retrieval system