KEGG   Luteibacter rhizovicinus: BJI69_08415Help
Entry
BJI69_08415       CDS       T04563                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
lrz  Luteibacter rhizovicinus
Pathway
lrz00071  Fatty acid degradation
lrz00072  Synthesis and degradation of ketone bodies
lrz00280  Valine, leucine and isoleucine degradation
lrz00310  Lysine degradation
lrz00362  Benzoate degradation
lrz00380  Tryptophan metabolism
lrz00620  Pyruvate metabolism
lrz00630  Glyoxylate and dicarboxylate metabolism
lrz00640  Propanoate metabolism
lrz00650  Butanoate metabolism
lrz00900  Terpenoid backbone biosynthesis
lrz01100  Metabolic pathways
lrz01110  Biosynthesis of secondary metabolites
lrz01120  Microbial metabolism in diverse environments
lrz01130  Biosynthesis of antibiotics
lrz01200  Carbon metabolism
lrz01212  Fatty acid metabolism
lrz02020  Two-component system
Brite
KEGG Orthology (KO) [BR:lrz00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BJI69_08415
   00630 Glyoxylate and dicarboxylate metabolism
    BJI69_08415
   00640 Propanoate metabolism
    BJI69_08415
   00650 Butanoate metabolism
    BJI69_08415
  Lipid metabolism
   00071 Fatty acid degradation
    BJI69_08415
   00072 Synthesis and degradation of ketone bodies
    BJI69_08415
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BJI69_08415
   00310 Lysine degradation
    BJI69_08415
   00380 Tryptophan metabolism
    BJI69_08415
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BJI69_08415
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BJI69_08415
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    BJI69_08415
Enzymes [BR:lrz01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BJI69_08415
Exosome [BR:lrz04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BJI69_08415
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: APG03926
UniProt: A0A0G9H725
Position
1864142..1865428
Genome map
AA seq 428 aa AA seqDB search
MEKTQKRVGVVGGVRIPFCRNNTAYADVGNFGMSVKVLGSLVEKFGLHGTELGEVAMGAV
IRHSSDWNLAREALLSSGLAPTTPGITTARACGTSLDNAIVIANKIAAGQIEAGIAGGSD
TTSDVPIVYGQKLRKRLLALNRAKTLKEKFTVATRGFSLKELKPSFPGVAEPRTGKSMGD
HCELMAKEWKVGRLEQDELALSSHKKLAAAYETGFFDDLVVPFRGLKRDGFLRGDSTLEK
LSSLKPAFDKTTGQGTLTAGNSTGLSDGAAAVLLASDEWASNRGLSIQAYLTHAQISAVD
FVHGEGLLMAPTVAVPRMLKQAGLTLQDFDFYEIHEAFAAQVLCTLRAWESDDYCRNRLG
LDGPLGSIDPSKLNVYGSSLAAGHPFAATGARIVATLAKMLEQKGSGRGLISICTAGGMG
VTAILERP
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atggaaaagacgcaaaagcgcgtgggtgtggtcggcggcgtccgcattcccttctgccgc
aacaacaccgcctatgccgatgtcggcaatttcggtatgtcggtcaaggtgctgggatcg
ttggtcgagaagttcggcctgcacggtacggagctgggtgaggtcgccatgggcgccgtc
atccgccactcctccgactggaacctggcccgcgaggccctgctttcgtccggccttgcg
ccgacgacaccgggcatcaccacggcgcgcgcctgcggcacctcgctcgacaacgcgatc
gtcatcgccaacaagatcgccgccgggcagatcgaggccggtatcgccggcgggtcggac
accaccagcgacgttcccatcgtctacgggcagaagctgcgcaagcgcctgctcgcgctg
aatcgcgcgaagacgctcaaggagaagttcaccgtcgcgacgcgcggcttctccctgaag
gaattgaagccctccttccccggcgtggccgagccccgcacgggcaagtccatgggcgac
cattgcgagctgatggcgaaggaatggaaggtcggccgcctcgagcaggatgagctcgcg
ctctccagccacaagaagctggctgccgcttatgagaccggcttcttcgacgatctggtc
gtgccgttccgtggtctcaagcgtgacggcttcctgcgtggcgattccacgctggagaag
ctgtcctcgctgaagccggcgttcgacaagaccaccggccagggcacgctcaccgcaggc
aactccaccggcctgtccgatggcgccgccgccgtcctgctggccagcgacgagtgggcg
agcaatcgtggcctttcgatccaggcctacctcacgcacgcgcagatttccgccgtcgac
ttcgtccatggcgaaggcctgttgatggcgccgaccgtggccgtgccccgcatgcttaag
caggccgggctgaccttgcaggatttcgacttctacgagatccacgaagccttcgcggcc
caggtgctgtgcacgctgcgtgcatgggaatccgacgactattgccgcaaccggctgggg
ctcgatggcccgctgggatcgatcgatccgtcgaagctcaacgtctacggctccagtctc
gcggcgggtcatcccttcgcggcgaccggtgcgcgcatcgtcgccaccctggcgaagatg
ctcgagcagaagggctcgggccgcggcctgatttccatctgtactgcgggcggcatgggc
gtcacggcgatcctcgaacgtccctga

DBGET integrated database retrieval system