KEGG   Lactobacillus sakei: LSA0067Help
Entry
LSA0067           CDS       T00299                                 

Definition
putrescine carbamoyltransferase (EC:2.1.3.3)
Orthology
K13252  
putrescine carbamoyltransferase [EC:2.1.3.6]
Organism
lsa  Lactobacillus sakei
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
63798..64829
Genome map
AA seq 343 aa AA seqDB search
MKRDFIDTKDYTQAEIQYLIDLGLQIKKDIKAGDYPQLLSNRTLGMLFEESSTRTRVSFE
TAMTQLGGHAQYLAPGQIHLGSAESESLGDTAIVLSRLVDILMARVATHDTIETIANAAT
VPVLNGMTDYNHPTQEIGDIITMAEHLPAGKKLSDCKVVFVGDATQVCVSLMFVATKMGM
QFVQYGPKGYQIKPETLAIGQKNAEVSGGSVLITEDTDQAMRDADFVYTDVWYGLYESPL
SYDERMAIFYPKYQVNDELMAKAAKHAKFMHCLPANRGEEVTDSVLDSDASVAWDEAENR
LTAMRALLVYLMAPIIDYSDDTLNNLKDPALKDLLNNRIDSTK
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagagattttatcgatacaaaggattatacacaagcagaaattcaatatttaatt
gatttaggattgcaaattaaaaaagatatcaaagctggtgactatccacaattattaagc
aatcgcacattagggatgttattcgaagaatcatcaactagaacacgggtatcatttgaa
acagcaatgacccaacttggtgggcacgcccagtatttagcacctggtcaaattcacctt
ggcagtgctgaaagtgaatcattaggcgacaccgcaattgttttatcacgattagttgat
atcttgatggcccgggttgcaacacatgacacaatcgaaacaattgcaaatgcagccaca
gtacctgttttgaacgggatgactgattacaatcacccaacacaagaaatcggcgatatc
atcacaatggcagaacatttaccagctggtaagaagttaagcgattgtaaagtcgttttc
gtcggggatgccacacaagtctgtgtttcattaatgtttgtcgctactaagatgggcatg
caattcgttcaatacggaccaaaaggctatcaaatcaaaccagaaacattagcaatcggt
caaaagaatgctgaagtttcaggtgggagtgtcttaatcacagaagataccgatcaagca
atgagagatgctgattttgtttatacagatgtttggtacggtttatatgaatcaccactt
tcatatgacgaacggatggcaattttctatcctaaataccaagttaacgatgaattaatg
gctaaagctgctaaacatgctaaattcatgcactgtttaccagctaaccgtggcgaagaa
gtgacagatagtgttcttgattcagacgcttcagttgcttgggatgaagctgaaaaccgt
ttgacagccatgcgcgcattacttgtttatctcatggccccaattatcgattattcagat
gacacattaaacaacttaaaagatccagcattaaaagacttattaaataatcgaatcgat
tcaaccaaatag

DBGET integrated database retrieval system