KEGG   Lactobacillus sakei: LSA0100Help
Entry
LSA0100           CDS       T00299                                 

Gene name
gpm1
Definition
(RefSeq) phosphoglycerate mutase (EC:5.4.2.1)
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
lsa  Lactobacillus sakei
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:lsa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LSA0100 (gpm1)
   01230 Biosynthesis of amino acids
    LSA0100 (gpm1)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LSA0100 (gpm1)
  Energy metabolism
   00680 Methane metabolism
    LSA0100 (gpm1)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LSA0100 (gpm1)
Enzymes [BR:lsa01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     LSA0100 (gpm1)
Exosome [BR:lsa04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   LSA0100 (gpm1)
  Exosomal proteins of melanoma cells
   LSA0100 (gpm1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
96789..97496
Genome map
AA seq 235 aa AA seqDB search
MANLVIVRHGESVANQLKTYTGWSDVALTAKGRQQAHQVGRQIKDAGFQFSHVHTSLLKR
AILTSYIVLEELDQLALPMTKSWRLNERHYGALRGLNKDTTRTIFGVHQVARWRRSYTAL
PPLLIRSSTARRYRLVPRKSRPRGESLAQATQRLLPYWQDQVVPGLLAGQDQLIVAHGST
LRALIKVIEQISDQAIDGVEVANGEALYYQFGTDLTVLKKGRLALGSETDEEKEN
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atggcgaatttagtaattgttagacacggcgaaagtgtcgccaatcaactgaagacctat
accggttggtcagatgtggcactcaccgctaaagggcgacagcaagcccatcaagttggc
cggcagataaaagacgctggctttcaatttagccacgtgcacacgtctttattgaaacgg
gcaattttgaccagttacattgttttagaagaactcgatcaattggcgctaccaatgact
aagagttggcgcttgaatgaacgacactacggtgctttgcgtggcttgaacaaagacacg
acgagaaccatttttggtgtccaccaagtagcgcgctggcggcgcagttatacagcgctg
ccaccacttttaattcggtcatcaactgcgcgtcgctatcgcttagtgccacgtaagagt
cgaccacgcggcgaaagtttggcgcaagccacccaacgtttattaccttattggcaagat
caagtggtgccggggttacttgctgggcaagatcagctaattgttgcgcatggctcgact
ttgcgtgccttaattaaggttatcgaacaaatttcagatcaggccattgatggcgtggaa
gtcgcaaacggtgaagcgctttattatcaatttggcacagatttaacagtactcaagaag
ggaagactagcactaggtagtgaaacggatgaagagaaagaaaattaa

DBGET integrated database retrieval system