KEGG   Lactobacillus sakei: LSA0206Help
Entry
LSA0206           CDS       T00299                                 

Gene name
gpmA
Definition
phosphoglyceromutase (EC:5.4.2.1)
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
lsa  Lactobacillus sakei
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:lsa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LSA0206 (gpmA)
   01230 Biosynthesis of amino acids
    LSA0206 (gpmA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LSA0206 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    LSA0206 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LSA0206 (gpmA)
Enzymes [BR:lsa01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     LSA0206 (gpmA)
Exosome [BR:lsa04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   LSA0206 (gpmA)
  Exosomal proteins of melanoma cells
   LSA0206 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
198757..199446
Genome map
AA seq 229 aa AA seqDB search
MAKLVFIRHGQSEWNLSNQFTGWVDVNLSEEGVRQAQNAGALLKKEGILFDQAYTSVLTR
AIKTLHYALEGSDQLWIPETKSWRLNERHYGALQGQNKAEAAEKWGDEQVHIWRRSYDTL
PPLLDASDEGSAANDRRYAHLDPKAIPGGENLKVTLERVIPFWEDEIAPKLIDGQNIIVA
AHGNSLRALTKYIENISDEDIMDVEMATGEPVVYDLDENLNVVSKKKLN
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atggctaaattagtttttattcgtcacggacaaagtgaatggaacttatcaaaccaattc
actggttgggttgatgttaacttaagcgaagaaggcgtacgccaagctcaaaacgctggt
gctttattgaaaaaagaaggcatcctttttgaccaagcttacacatcagtattgactcgt
gccatcaagacattacactatgcacttgaaggttcagaccaattatggattcctgaaaca
aaatcatggcgtttaaacgaacgtcattatggtgcattacaaggccaaaacaaagctgaa
gcagctgaaaaatggggcgacgaacaagttcacatctggcgtcgttcatacgatacactt
cctccactattggatgcaagtgatgaaggttcagcagcaaacgaccgtcgttacgcacac
ttagatccaaaagcgattcctggtggcgaaaacttgaaggttactttggaacgtgttatc
ccattctgggaagacgaaatcgctccaaaattaatcgacggccaaaacatcattgttgca
gctcacggtaactcactacgcgccttaacaaaatacatcgaaaacatctctgatgaagac
atcatggacgttgaaatggcaacaggcgaaccagttgtttatgatttagatgaaaactta
aacgtagtaagcaagaagaaattaaactaa

DBGET integrated database retrieval system