KEGG   Lactobacillus sakei: LSA0220_cHelp
Entry
LSA0220_c         CDS       T00299                                 

Gene name
dapE
Definition
succinyl-diaminopimelate desuccinylase (EC:3.5.1.18)
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
lsa  Lactobacillus sakei
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:lsa01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:lsa00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(217034..218332)
Genome map
AA seq 432 aa AA seqDB search
MMEKTEKIAILEKLVSIDTTDQAEGVIADYLADLFTQHGIQTEKVASKPGRENLVAYLGE
ATDKVLAVTGHMDVVSIGDRSKWTSDPFTLTARDGKLFGRGATDMKSGLAALVIAMIELH
DQNVPLNGQIKLLATVDEEKNETGAQTLTAQGYADNLTALLVAEPSGVDKQALANSTDKF
PTEMVQKLLAANQTNEQHFLIFAHNGSLDFKVTATGKTAHSSMPELGINAIDHLLAYYNR
QKQYFDQKHPIDDVLGDIVPVTTLINGGEQINSVPGHAELTCRVRTTPALTGDQVIADLN
AIIAELNQQTDMNLALTVINNQPPVKSNPQAPFIQSVQKIGAQKLSQAYPLMHVAGGTDA
AHFAKNNPNLPVAVVGPGNDTSHMIDEYVDEERLLCQESGHKSTSKFDFQFKLLNLIFGG
RSFSPVQILKTL
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atgatggaaaaaactgaaaaaatcgcaattttagaaaaactggtctcaattgatacaaca
gaccaagcagaaggtgtgattgccgactacttagccgatctattcacacaacacggtatc
cagactgaaaaagtggcttctaaaccaggccgcgaaaacttagtggcctatctaggtgaa
gcaaccgacaaagtcctcgccgtgactggtcatatggacgtcgtcagcatcggcgatcgc
agcaaatggacgagtgatcccttcaccctaaccgctcgcgatggtaaactcttcggtcgg
ggtgctactgacatgaaatctggactggccgctcttgtgattgcaatgatcgaattacac
gatcaaaacgtcccattaaacggtcaaatcaaactccttgcaacagtcgatgaagaaaag
aacgaaactggtgcccaaactttaactgcacaaggttatgccgataatttgacagcctta
ttagttgccgaaccatctggcgttgataagcaagccttagcaaacagcaccgacaaattt
cccacagaaatggtccaaaaattactcgcagctaatcaaaccaatgaacaacattttctg
attttcgcccacaacggttcccttgattttaaagtgactgcaactggtaaaacagcccac
agttcaatgcctgaactcggtattaacgcaattgatcatttgctcgcctactataatcgt
caaaaacaatacttcgatcaaaagcatcccatcgatgatgtcctcggcgatattgttccc
gtcacaaccttaatcaatggtggtgaacaaattaattcggtccccggtcacgcagaactc
acttgccgcgttcgcacgacccccgcattaactggcgaccaagtcattgccgatctcaat
gccattattgctgaacttaaccaacaaacagacatgaatttagcattaactgtcattaat
aaccaaccaccggttaaaagtaatccacaggcaccattcattcaaagtgttcaaaaaatc
ggcgcacaaaagttatcccaagcttatccactgatgcacgttgctggtggtactgatgcc
gcccactttgctaagaataaccccaacttaccagtggcagttgtcggccccggcaatgat
accagtcatatgatcgacgaatacgttgacgaagaaaggctcctatgtcaagaatccgga
cataaaagtacgagcaaatttgactttcaatttaaattacttaatttaattttcggaggc
cgaagttttagtcccgttcagattttaaaaacgctttag

DBGET integrated database retrieval system