KEGG   Lactobacillus sakei: LSA0258Help
Entry
LSA0258           CDS       T00299                                 

Definition
iron-containing alcohol dehydrogenase
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
lsa  Lactobacillus sakei
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Class
Metabolism; Overview; Degradation of aromatic compounds [PATH:lsa01220]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:lsa00010]
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:lsa00071]
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:lsa00350]
Metabolism; Xenobiotics biodegradation and metabolism; Chloroalkane and chloroalkene degradation [PATH:lsa00625]
Metabolism; Xenobiotics biodegradation and metabolism; Naphthalene degradation [PATH:lsa00626]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
253021..254172
Genome map
AA seq 383 aa AA seqDB search
MDYKLVQKTKVLVTDDLPKTILSILKETQYKKPLIVMDSFLKEVAIVKRLQVKLTENNIQ
FSIYDKVVSDPPTTVVDEGAEFFKAQDCDSLIAIGGGSAIDVARGINIVRINGGKISEYV
TASNEIKDCPGLIAVPTTSGTGSELSNALIVTDTENQTKLAVLANNAVSEFAVLNPELVM
TLPKGMTIATGLDAFSHAAEGYTSTLASPVTDAICEKIMYLLVKYLPKVIEDGQDREARE
RVMVAATLGGWMLNNAGTHAGHSVAHVIGSKYHMPHGMACAYALPGVLQFIAPVRSKKVK
EIGLILGAEYPADPTDTEIGRITAIQYREFRDKVLGMKPFTDFNISEDELLTNIESVVNE
RFAGNTPKQIDQEGAMMLLKNFG
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atggattataaattagttcaaaagaccaaagtattagtaaccgatgatttacctaaaacg
attttgagtattttgaaagaaacacaatataaaaagccattaattgttatggatagtttt
ttaaaagaagttgcaattgtaaaaagattgcaagttaaattgacggagaacaatattcaa
ttctctatctatgataaagtcgtttctgatccgccaacaactgtggtggatgaaggtgct
gaattttttaaggcgcaagattgtgatagtttaattgcaattggcggtggcagtgccatt
gatgttgctagaggaattaatatcgttcgtataaatggtggcaaaattagcgaatacgtc
acagcaagtaacgaaataaaagattgccctggattgatagcagtaccaacaacttctggt
acggggagtgaattatcgaatgcattaatcgttacggatacagaaaatcagaccaaatta
gcggtgttagcgaataacgcagttagtgaatttgcagttttgaaccctgaattagtaatg
acattacctaaagggatgacaattgcaacgggcttagatgcgttttcacacgcggcagaa
ggttatacatcaaccttagcgagtcctgtcacagatgcgatttgcgaaaaaattatgtat
ttactagtcaaatacttacctaaggtaattgaagatggacaggatcgagaagcacgtgaa
cgtgtgatggtcgctgctacactaggtggttggatgctaaataatgcagggacacatgct
ggtcattccgttgcacatgtgattggatctaagtaccatatgccccatggaatggcttgt
gcttatgcgttacctggggtacttcaatttattgcaccagttagaagtaaaaaagtaaaa
gaaattggtttgattttgggcgctgaataccccgcagatccaacagataccgaaattggt
agaattacggctattcaatatcgtgaatttagagataaagttcttgggatgaagccattc
actgattttaatatctcagaagatgaattgctaactaatatagaaagtgtcgttaatgaa
cgttttgcgggaaatacacctaagcaaattgatcaagagggcgcaatgatgttattgaaa
aactttggctag

DBGET integrated database retrieval system