KEGG   Lactobacillus sakei: LSA0258Help
Entry
LSA0258           CDS       T00299                                 

Definition
iron-containing alcohol dehydrogenase
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
lsa  Lactobacillus sakei
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:lsa00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    LSA0258
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LSA0258
  Lipid metabolism
   00071 Fatty acid degradation
    LSA0258
  Amino acid metabolism
   00350 Tyrosine metabolism
    LSA0258
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    LSA0258
   00626 Naphthalene degradation
    LSA0258
Enzymes [BR:lsa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     LSA0258
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
253021..254172
Genome map
AA seq 383 aa AA seqDB search
MDYKLVQKTKVLVTDDLPKTILSILKETQYKKPLIVMDSFLKEVAIVKRLQVKLTENNIQ
FSIYDKVVSDPPTTVVDEGAEFFKAQDCDSLIAIGGGSAIDVARGINIVRINGGKISEYV
TASNEIKDCPGLIAVPTTSGTGSELSNALIVTDTENQTKLAVLANNAVSEFAVLNPELVM
TLPKGMTIATGLDAFSHAAEGYTSTLASPVTDAICEKIMYLLVKYLPKVIEDGQDREARE
RVMVAATLGGWMLNNAGTHAGHSVAHVIGSKYHMPHGMACAYALPGVLQFIAPVRSKKVK
EIGLILGAEYPADPTDTEIGRITAIQYREFRDKVLGMKPFTDFNISEDELLTNIESVVNE
RFAGNTPKQIDQEGAMMLLKNFG
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atggattataaattagttcaaaagaccaaagtattagtaaccgatgatttacctaaaacg
attttgagtattttgaaagaaacacaatataaaaagccattaattgttatggatagtttt
ttaaaagaagttgcaattgtaaaaagattgcaagttaaattgacggagaacaatattcaa
ttctctatctatgataaagtcgtttctgatccgccaacaactgtggtggatgaaggtgct
gaattttttaaggcgcaagattgtgatagtttaattgcaattggcggtggcagtgccatt
gatgttgctagaggaattaatatcgttcgtataaatggtggcaaaattagcgaatacgtc
acagcaagtaacgaaataaaagattgccctggattgatagcagtaccaacaacttctggt
acggggagtgaattatcgaatgcattaatcgttacggatacagaaaatcagaccaaatta
gcggtgttagcgaataacgcagttagtgaatttgcagttttgaaccctgaattagtaatg
acattacctaaagggatgacaattgcaacgggcttagatgcgttttcacacgcggcagaa
ggttatacatcaaccttagcgagtcctgtcacagatgcgatttgcgaaaaaattatgtat
ttactagtcaaatacttacctaaggtaattgaagatggacaggatcgagaagcacgtgaa
cgtgtgatggtcgctgctacactaggtggttggatgctaaataatgcagggacacatgct
ggtcattccgttgcacatgtgattggatctaagtaccatatgccccatggaatggcttgt
gcttatgcgttacctggggtacttcaatttattgcaccagttagaagtaaaaaagtaaaa
gaaattggtttgattttgggcgctgaataccccgcagatccaacagataccgaaattggt
agaattacggctattcaatatcgtgaatttagagataaagttcttgggatgaagccattc
actgattttaatatctcagaagatgaattgctaactaatatagaaagtgtcgttaatgaa
cgttttgcgggaaatacacctaagcaaattgatcaagagggcgcaatgatgttattgaaa
aactttggctag

DBGET integrated database retrieval system