KEGG   Lactobacillus sakei: LSA0289Help
Entry
LSA0289           CDS       T00299                                 

Gene name
xpk
Definition
phosphoketolase (EC:4.1.2.9)
Orthology
K01621  
phosphoketolase [EC:4.1.2.9]
Organism
lsa  Lactobacillus sakei
Pathway
Pentose phosphate pathway
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:lsa00030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
286496..288859
Genome map
AA seq 787 aa AA seqDB search
MTDYSSKEYLAKVDAFWRAANYISVGQLYLKDNPLLQRPLEAKDVKVKPIGHWGTISGQN
FLYAHLNRAINKYDLNMFYVEGPGHGGQVMVSNSYLDGSYTEIYPEISQDVDGMKKLFKQ
FSFPGGVASHAAPETPGSIHEGGELGYSLSHGVGAILDNPDVIAAVVVGDGEAETGPLAA
SWLSSTFINPKNDGAVLPILNLNGFKISNPTILSRKSDEELTKYFEGNGWAPIFVEGDDP
EKMHPATAAAMDEAIEKIQAIQKAARENGDTSRPVWPMIVFRAPKGWTGPKTWDGVPIEN
SFRAHQIPVPIDSTDMQHADALVDWMKSYRPEELFTAEGQLKPEIAAMAPKGDKRMAANP
ITNGGIDPKPLRLPDYRDYAVDNTEHGKVVAQDMIVLGEYVRDIIKDNDQNKNFRIFGPD
ETMSNRLNHIFDVTNRQWMEPIKEPNDQFMATEGRVLDSQLSEHQAEGWLEGYVLTGRHG
FFASYESFLRVVDSMLTQHFKWLRKADEQAWRNKYPSLNVIATSTVFQQDHNGYTHQDPG
VLTHLAEKKPEFIREYLPADANTLLATMNTVFQSQEKINLVIASKHPRQQWFSIDEATVL
VKNGLKIIDWASTDQDAEPDVVIAAAGTEPTLESLAAISILHKQYPDMKIRFINVVDLLK
LRSPKVDPRGLTDEEFDMYFTKDKPVVFAFHGFEGLVRDIFFDRHNHNLHVHGYRENGDI
TTPFDMRVLNQMDRYNLSKEVAIDVLGDQAGQFAQSMDDMVAKHNQYIRDEGTDLPEVEE
WQWTPLR
NT seq 2364 nt NT seq  +upstreamnt  +downstreamnt
atgacagattattcaagtaaagaataccttgctaaagttgatgcattttggcgagcagct
aactatatctcagtaggccaattatatttaaaagacaatccattattacaacgtccctta
gaagcaaaagacgttaaagttaaaccaatcggacactggggcacaatctcaggacaaaac
ttcttatacgcacatttgaaccgtgccattaacaagtacgacttgaacatgttctacgtt
gaaggcccaggtcatggtggccaagtcatggtttcaaattcatacttagacggtagttat
acagaaatctacccagaaatttctcaagatgttgatgggatgaagaaattattcaaacaa
ttctcattcccaggcggcgttgcttctcatgctgctcctgaaacacctggttcaatccac
gaaggtggcgaacttggttattcattatcacacggtgttggtgcaattttagacaaccca
gacgtcatcgcagctgttgttgttggtgatggggaagctgaaactggcccattggcagca
tcatggttatcaagcacatttatcaatcctaaaaatgatggtgctgtcttaccaatcttg
aacttaaatggtttcaagatttctaacccaacaatcctttcacgtaagagtgacgaagaa
ttaacaaaatacttcgaaggtaacggttgggcaccaatctttgttgaaggcgacgatcct
gaaaaaatgcacccagcaactgctgctgcaatggatgaagccatcgaaaaaatccaagcg
attcaaaaagctgctcgcgaaaacggcgatacatcacgtccagtatggccaatgatcgtc
ttccgcgctcctaaaggctggactggtcctaagacatgggatggcgtaccaatcgaaaat
tcattccgtgcacatcaaattccagtgccaattgatagcactgacatgcaacatgccgat
gcattagttgattggatgaagtcatatcgtccagaagaattatttacagctgaaggtcaa
ttaaaacctgaaatcgctgcaatggcacctaagggcgacaaacgaatggctgctaaccca
attacaaatggtgggattgatcctaaaccacttcgcttgccagattaccgtgactacgct
gtggataacacagaacatggtaaagttgttgcgcaagacatgattgttttaggtgaatat
gtccgcgatattattaaagacaatgatcaaaacaaaaacttcagaatctttggccctgac
gaaacaatgtcaaaccgtttgaaccacatctttgatgtgacaaaccgtcaatggatggaa
ccaatcaaagaaccaaatgatcaattcatggcaacagaaggccgtgtccttgattcacaa
ttatcagaacatcaagctgaaggctggttagaaggctatgtcttaacaggtcgtcacggc
ttcttcgcaagttacgaatcattcttgcgcgttgtggattcaatgttaacacaacacttc
aagtggttaagaaaagcagacgaacaagcatggcgtaacaagtatccttcattgaacgtg
attgcaacttcaactgttttccaacaagatcacaatggttacactcaccaagatccaggt
gtcttaacgcacttagctgaaaagaaacctgaattcatccgtgaatacttaccagctgat
gccaacacattattggcaacaatgaatactgtcttccaaagccaagaaaaaattaactta
gtgattgcttcaaaacacccacgtcaacaatggttctcaattgatgaagcaactgtctta
gttaaaaacggcttgaagattattgattgggcaagtacagatcaagatgctgaaccagac
gttgtgattgcagctgctgggacagaaccaacacttgaaagtttggctgctatctcaatc
ttacacaaacaatatcctgacatgaagattcgtttcattaacgttgttgatctattgaaa
cttcgttcacctaaagtggatcctcgtggcttaacagatgaagaattcgatatgtacttt
acaaaagacaaaccagttgtcttcgctttccatggtttcgaaggcttagtgcgtgacatc
ttcttcgatcgtcacaaccataacctccatgttcatggctatcgtgaaaatggtgatatc
acaacaccattcgacatgcgtgtcttgaaccaaatggatcgttacaacttatctaaagaa
gtcgcaattgacgtgcttggtgaccaagccggccaattcgcacaatcaatggatgatatg
gttgctaaacacaaccaatacattcgtgatgaaggtactgatttacctgaagttgaagaa
tggcaatggacaccactccgttaa

DBGET integrated database retrieval system