KEGG   Lactobacillus sakei: LSA0366Help
Entry
LSA0366           CDS       T00299                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
lsa  Lactobacillus sakei
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:lsa00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    LSA0366 (ruvA)
Enzymes [BR:lsa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     LSA0366 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
369905..370516
Genome map
AA seq 203 aa AA seqDB search
MYEYLKGLVTAVNPYYVVLEVQGIGYQLQVANPYRYTESMSEVVQIFVHQAVRDTDITLF
GFYDLDEKQLFQKLISVSGIGPKSALAILANSDHSGLIQAIMNDDIGYLTKFPGVGKKTA
QQIALDLKGKLGDLEQSATLVGQTAIDLGSQGDSPELSDALAALSALGYSAREVKAITPK
LTDFAAQTTDQYLREGLRLLMKK
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgtatgaatatttaaagggtttagtgacggcggttaatccgtattacgttgttttggaa
gtccaaggaattggctatcaattgcaagttgccaacccatatcggtatacggaatcgatg
agcgaagtggttcaaatttttgtccaccaagcggtacgcgatactgatattacgcttttt
ggcttttacgacttagatgaaaaacaacttttccaaaaattaatcagtgtttccggaatt
ggtcccaagagtgccttggcaattttggctaacagtgatcattctggcttaattcaggcg
attatgaacgatgatattgggtacttaacgaagttcccaggcgttgggaagaagacggcc
caacagattgccttagatcttaaaggtaagttaggtgatctagaacaaagcgcaacgtta
gtcggccaaacggcaattgatttaggcagccaaggcgattcacctgaattaagtgatgca
ctagcggccttgagtgcgcttggttattccgcacgggaagtcaaagcgattacgcctaag
ttaactgattttgcagcgcaaacaactgatcaatatctcagagaaggtttgcggttattg
atgaagaaataa

DBGET integrated database retrieval system