KEGG   Lactobacillus sakei: LSA0379Help
Entry
LSA0379           CDS       T00299                                 

Gene name
adhE
Definition
bifunctional acetaldehyde-CoA/alcohol dehydrogenase (EC:1.1.1.1 1.2.1.10)
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
lsa  Lactobacillus sakei
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:lsa00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    LSA0379 (adhE)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LSA0379 (adhE)
   00620 Pyruvate metabolism
    LSA0379 (adhE)
   00650 Butanoate metabolism
    LSA0379 (adhE)
  Lipid metabolism
   00071 Fatty acid degradation
    LSA0379 (adhE)
  Amino acid metabolism
   00350 Tyrosine metabolism
    LSA0379 (adhE)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    LSA0379 (adhE)
   00626 Naphthalene degradation
    LSA0379 (adhE)
Enzymes [BR:lsa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     LSA0379 (adhE)
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     LSA0379 (adhE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
383622..386216
Genome map
AA seq 864 aa AA seqDB search
MVKKEGVKAVVDAVSEVDKMVTDLVTRAHEALKIMETFDQAKVDHIVHQMAIAGLDHHME
LAKMAVEETGRGIYEDKAIKNIFATEEIWHAIKDNKTVGVIEEDPEHGITKIAEPVGVIA
GVTPVTNPTSTTIFKAEIAIKTRNPIIFAFHPNAQKCSARALEVIKEEAVKAGLPADALL
FIEEPSLAATQALMNHTGIATVLATGGPGMVKAAYSTGKPALGVGAGNAPAYIEESANIK
QAVNDLILSKSFDNGMICASEQAVIVDAKIYNEVKKEFQAQGVYFAKASELPALNEAIID
PAKNAVRPAIPGQSAANIAKLAGIDIPEDTPVLIAEIKGVGHQYPLSHEKLSPVLAMIKA
KDREDGLALCEAMLDLGGLGHTASLHTTDDALPLEFARRMKACRVLVNTPSAQGGIGDLY
NEMIPSLTLGCGSYGHNSISHNVSTIDLLNIKTLAKRRNNMQWVKLPSKIYFEKNSVNYL
EKMADLNKVFIVADQGMVNLGYVRIVEEVLAKRANDVQMQIFSDVEPDPSTNTIYKGAAA
MRSFEPDAIVAIGGGSVMDAAKGMWLFYDSEEADFFGAKQKFLDIRKRTYKFPKLNKTKL
ICIPTTSGTGSEVTPFAVITDSETHIKYPLADYALTPDVAIVDSQFVESVPPRVVAHTGL
DVLCHATESYVSTMASNYTKGLSLQAIKLVFDNLKASYDGDITAKGNMHDASTMAGMAFA
NALLGINHSLAHKLGGAFNLPHGLMIAITMPHVIRYNATTPTKRALWAKYSYFRADEDYA
EIARYIGLKGNTTAELVEAYANAVTELAESVGIQMSLKANGVTKADFKQHVDELAELAYE
DNCTVTNPKEPLIKELKGILEAEF
NT seq 2595 nt NT seq  +upstreamnt  +downstreamnt
atggttaaaaaagaaggcgttaaagcggttgttgatgcggtatctgaagtggataagatg
gtgacggatttagtcacacgggcccatgaagcacttaaaatcatggaaacattcgatcaa
gcaaaggtggatcatattgtccaccaaatggcgattgccggccttgatcatcatatggaa
ttagctaaaatggccgttgaagaaacgggtcgtgggatttatgaagataaagccattaaa
aatattttcgcaacggaagaaatttggcacgcgattaaagataataagacagttggtgtc
attgaagaagatcctgaacatgggattactaagattgcggaaccagtcggggtcattgct
ggggtaacacctgttaccaacccaacttcaaccacaatttttaaggcagagattgccatt
aaaacacggaatccaatcatctttgcttttcatcccaatgctcaaaaatgttctgccaga
gcactagaagtcattaaagaagaagccgttaaagctggcttaccagctgacgccttatta
ttcattgaagaacctagtttggcagccacccaagctttgatgaatcataccggcattgca
acggtcctagcaactggtggaccagggatggtcaaggctgcttattcaactgggaaacca
gcattaggggttggggctggtaacgcaccagcttatatcgaagaatcagccaatatcaaa
caagcagtcaatgatttaattctatcgaaatcatttgataacgggatgatctgcgcatca
gaacaagcagtgattgtcgatgctaaaatctacaacgaagttaaaaaagaattccaagca
caaggtgtctattttgctaaagcaagtgaattaccagctttaaacgaagcaattattgat
ccagctaaaaacgctgtgcggccagcaattcctggtcaatcagctgctaatattgctaag
ttagctgggattgatattccagaagatacacccgttttaattgctgaaatcaagggtgtt
ggtcatcaatatccactttcacatgaaaaattatcaccagtcttagcgatgattaaagct
aaagaccgtgaagatgggttggcattatgcgaggcgatgcttgatctgggtggcttgggc
cacacagcatcattgcatacgactgacgatgcgttaccattagaatttgcaagacggatg
aaggcttgtcgtgtattggtcaatacaccatctgcccaaggtgggattggtgatttatac
aacgaaatgattccatcattaacacttggctgtggctcttatgggcataactcaatttca
cataacgtctcaacaatcgacttattgaatattaaaacattggcgaaacgccgcaataat
atgcaatgggtcaaattgccaagcaaaatctattttgaaaaaaattcggtcaactattta
gaaaagatggctgatttaaataaggtttttatcgtcgctgatcaggggatggttaacctt
ggttatgtccggattgttgaagaagtgttagctaaacgggcgaatgacgttcaaatgcaa
atcttctcagatgttgaaccagatccatcaacaaacacgatttataagggtgctgcagcg
atgcggagttttgaaccagatgcaatcgtcgcaattggtggcggttctgtcatggatgct
gctaaagggatgtggttattctatgattcagaagaagccgacttctttggcgcaaaacaa
aaattcttagacattcgcaaacggacttacaagttccctaaacttaacaaaacgaagtta
atctgtatcccaacgacttccgggacgggttcagaagtaacaccttttgcggtgattact
gatagtgaaacccatattaaatacccattggcagattatgcattgacaccagacgttgcg
attgttgacagtcaatttgtcgagagtgtgccaccacgagttgttgcacacactgggttg
gatgtgctctgtcatgcgactgaaagttacgtatcaacaatggcttctaactacacgaag
gggcttagtttacaggcgattaaattagtttttgataacttgaaggctagttacgatggc
gatattacggccaaaggtaacatgcacgatgcctcaacaatggcggggatggcctttgcg
aatgcgttattaggcatcaaccattcactggcacataaattaggcggggcgttcaactta
cctcacggtttaatgattgccatcacgatgccgcatgttatccgctataatgcgacaacg
ccaaccaaacgggcactctgggctaaatatagttacttcagagctgatgaagattacgcc
gaaatcgcacgttatattgggttgaagggtaatacgacagcagaacttgttgaagcttat
gcaaatgcagtgactgaattggccgaaagtgttggcattcaaatgagtttgaaagctaat
ggcgtcacaaaggcggacttcaagcaacatgtggatgagttagctgaattagcttatgaa
gacaactgtactgttacaaatccaaaagaaccattgattaaagaattaaaaggcatttta
gaggcagaattttaa

DBGET integrated database retrieval system