KEGG   Lactobacillus sakei: LSA0805Help
Entry
LSA0805           CDS       T00299                                 

Gene name
recD
Definition
exodeoxyribonuclease V subunit alpha (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
lsa  Lactobacillus sakei
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:lsa00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    LSA0805 (recD)
Enzymes [BR:lsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     LSA0805 (recD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
797333..799861
Genome map
AA seq 842 aa AA seqDB search
MAILETENMVDNKPTVTGTVQSVFYENPGNFFKILLIKIAHKTIDWHEPEIVVTGSFGEI
KEDERYTFYGKVITHPKYGQQFQADNYQVDQPTTKTGLVAYLSGEKFAGIGQKTAEKIVD
TLGLDAIDKILADSTVLAPLGLNDKKQATLVETLTINNGMEQIIIGLNNYGFGSSMAYNI
YQTYHEDTLKIIQENPYQLVADIAGIGFKRADNLAEKIGFAADSPARIQGALMQALNELT
NQAGDTFTQAKPLLAASIQLMEQARNVAIDPNLVAEQLMVLAHDGKVVGDENRIYPNGLY
NAEWQIANHLMRIENERDKISYPKHDLDKEIRRLEKRFKMSYDDVQKNAIKLAMTHRAFL
LTGGPGTGKTTIINGIVTLFAELNGLSLDINEYKDTPFPILLAAPTGRAAKRMSETTGLP
ASTIHRLLGITGRENNPDIDSKELEGGLLIVDEMSMVDTYLFRSLIRAVPSNMQVVFVGD
KDQLPSVGAGQVFFDLLQSQAIPAIELQQIYRQDDESTIIPLAHEINQGQLPADLLQPQK
DRSFIQCSPYQIESVIKQVVTKAKDRGFETKDIQVLAPMYRGAAGIDQLNPMIQNIMNPK
VDDRKKQVSLGNVHYRIGDKILHLVNSPELNVFNGEIGQITGITYAKDSDDKMDELTIAF
DSTEITYKRTEWHKITLAYCTSIHKAQGSEFEMVILPLVNQYQRMLKRNLLYTAVTRARS
LLILIGEPSAFDKAAKELSANRQTTLKERIISVFNGEKVSQAVKTASVGLTEAKPTVEKL
TPAKAAAPEQLALVDDADDSEETIQEAPANYELTPALVSGHQIDPMIGMADLTPYTFMTS
AK
NT seq 2529 nt NT seq  +upstreamnt  +downstreamnt
atggcgattttggaaacagaaaatatggtcgataataaaccaaccgttaccggaacggtc
caaagtgttttttacgagaatcccggtaacttttttaagattctcttgattaaaattgcc
cataagacaatcgattggcacgagccagagattgtcgtgactggtagttttggtgagatt
aaagaagacgaacgctatacgttttatggcaaagtcatcacccatcctaaatacggtcaa
caatttcaagctgacaactatcaggttgaccaaccgacgactaagactggcttagtcgcc
tatttatctggcgaaaaatttgccggcattggtcaaaaaacggctgagaaaattgtcgat
accttaggattagatgcgattgataagatcttagcggactcaactgttttagcgccgctg
ggtttaaatgataagaaacaagcgacgttggttgaaacgctgacgattaacaatggcatg
gaacaaattatcattggtctcaataattacggttttgggagctcgatggcctataacatc
taccaaacttatcacgaagataccttgaagattattcaagaaaatccttatcaactagtg
gccgacattgccggtattgggtttaaacgagcggataatttagctgagaagattgggttt
gcagccgattcaccagcgcggattcaaggggcgctgatgcaagccttgaacgaactgacc
aatcaggccggcgatacgtttacccaggcgaagccgttattagcagccagcattcaattg
atggaacaggcccggaacgtggcgattgatccgaatttagtggcagagcaattaatggtc
ttggcacacgatggcaaagtcgttggtgatgaaaatcggatttatccgaatggtttgtac
aacgcggaatggcaaattgccaaccacttgatgcggattgaaaatgaacgggataaaatt
agttatcctaaacatgatctggataaagaaattcgccggctcgaaaaacgctttaagatg
agctatgatgatgtccaaaaaaatgcaattaaattagcgatgactcacagagcctttcta
ctaacagggggccctggtactgggaaaacaacgattattaatgggattgtgactttattt
gctgagttaaacggtctttcgcttgatatcaacgaatataaagacacaccattcccaatt
ttattggcagcgcctactgggcgggccgctaaacggatgagcgaaacaactggcttgcca
gctagcacgattcatcgcttattaggaattacgggacgtgaaaataatcctgatatcgat
agtaaggaactagaaggcggcttattaattgtcgatgaaatgtcgatggttgatacgtac
ctctttagatcattgattcgagcagtgcctagcaatatgcaagtcgtctttgttggtgat
aaagatcagttgccatcagttggcgcggggcaagtcttttttgatttactgcagagtcag
gcaattccggcaatcgaactgcaacaaatctatcgacaagacgatgagtcgacgattatt
ccgctagctcatgagattaatcagggccaactaccagccgatctactccaaccgcaaaag
gatcggagctttattcagtgcagtccttatcagattgaatcggtgattaagcaagtggtc
actaaagcaaaagaccggggctttgaaacaaaagatattcaggtgctagcaccgatgtat
cggggcgcagccggaattgatcaattaaatccaatgattcaaaatatcatgaatccaaag
gtcgatgatcgtaagaaacaagtcagtttaggtaacgttcattatcggattggcgataag
attttacatctggttaatagtccggaactaaacgtttttaacggtgaaatcgggcaaata
accgggattacgtatgctaaagatagtgatgacaagatggacgagttaacgattgccttt
gatagtaccgaaattacctataaacggacggaatggcataaaattacgttggcgtattgt
acgtcgattcataaggctcaaggttctgaatttgaaatggtaattctacccttggttaac
caatatcaacggatgctgaaacgaaacttgttgtatacagcagtgacacgggcgcggtcc
ttactgattttaattggggaaccaagtgcttttgataaggcggccaaggaactctccgca
aatcggcaaacaacgcttaaggaacggattatcagcgtctttaatggcgaaaaagtgagc
caagcggtcaaaaccgctagtgttggcttaacggaagctaaaccaactgttgaaaaacta
accccggctaaagcagcagcgccagaacaattggcattagtggacgatgcagatgacagc
gaagaaacaattcaagaagcacctgctaattatgaattaacaccagccttggtgagtggt
catcagattgacccgatgattgggatggcggatttaacgccgtacacattcatgacaagt
gctaagtag

DBGET integrated database retrieval system