KEGG   Lactobacillus sakei: LSA0925Help
Entry
LSA0925           CDS       T00299                                 

Gene name
adh
Definition
zinc-containg alcohol dehydrogenase (oxidoreductase)
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
lsa  Lactobacillus sakei
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:lsa00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    LSA0925 (adh)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LSA0925 (adh)
  Lipid metabolism
   00071 Fatty acid degradation
    LSA0925 (adh)
  Amino acid metabolism
   00350 Tyrosine metabolism
    LSA0925 (adh)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    LSA0925 (adh)
   00626 Naphthalene degradation
    LSA0925 (adh)
Enzymes [BR:lsa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     LSA0925 (adh)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
915956..916996
Genome map
AA seq 346 aa AA seqDB search
MKAATFIEPGKMVITEAPKPTIEKKTDAVIRIIRACVCGSDLWWYRGLSKRESGSLVGHE
AIGVVESVGEAVTDIKAGDFVIVPFTHGCGHCAACLAGFDGDCTNQEGGGNGGYQGEFLR
YTNANWGLVKIPGQPADYSDEMLNNLLTLSDVMATGYHAAVSAEVKPGDTVVVMGDGAVG
LCGVIGAKLLGAEQIIAMSRHEDRQKLALEFGATDIVAERGDEAVAKVMALTDNAGANAV
LECVGTEQSVATAVAVAGAGAVIGRVGIPQKAEMNTNVLFRKNIGLRGGIAAVTTHDKAR
LLDAVLKGEINPGKVFTQRFNLDDIQAAYEAMDQRQAIKSLLVISD
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagcaacttttattgaaccaggaaaaatggtgattactgaggcacctaaacca
acaatcgaaaagaagacagatgccgttattcggattattcgggcttgcgtctgtggctct
gatttatggtggtatcgtggcctttcaaaacgtgaatcaggatcactagtcggacatgaa
gcaatcggtgttgttgaatccgttggtgaagcagtgactgatattaaagctggagatttt
gtaattgtcccatttacgcatggttgcggacactgtgctgcttgtttagctggcttcgat
ggtgattgtacaaaccaagaaggcggtggcaatggtggttatcaaggtgaattcctccgt
tataccaatgctaattggggtttggttaaaatccctggccaaccagctgattattcggac
gaaatgttaaataatctcttaacactttcagacgttatggcaactgggtatcacgccgct
gtttctgctgaagttaaacctggtgacacagtggtcgtcatgggagatggtgcagttggt
ttatgtggtgtaatcggtgctaaattattaggtgcagaacagattatcgccatgagtcgt
catgaagatcggcaaaaactagcactagaattcggtgcaactgatattgttgctgaacgt
ggggacgaagctgttgcaaaagtgatggcactaactgacaacgctggggctaacgccgtc
ttagaatgtgtcgggactgaacaatccgttgcaacagcggtagccgttgctggcgcgggt
gctgttatcggtcgtgttgggattccacaaaaggcagaaatgaataccaacgtcttattc
cggaagaacatcggcctccgtggtgggattgcggcagtcacaacccatgataaagcacgg
ttactcgacgctgttttaaagggtgaaatcaaccctggtaaggtcttcacgcaacgcttt
aacctagatgatattcaagctgcttacgaagcaatggatcaacgccaagccatcaaatca
ttattagtgattagcgattaa

DBGET integrated database retrieval system