KEGG   Lactobacillus sakei: LSA0952Help
Entry
LSA0952           CDS       T00299                                 

Gene name
pyrB
Definition
aspartate carbamoyltransferase (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
lsa  Lactobacillus sakei
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:lsa00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:lsa00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
938789..939706
Genome map
AA seq 305 aa AA seqDB search
MTNQTAIVSVEQLTNSSVLNLIERAEAFKQGATCELTRPVYAMNLFFENSTRTKTSFEMA
ERKLGLSVMSFEAETSSVSKGETLSDTLKTVQAIGVDFVAVRHPQNYYYDDLLADPAFHL
ALANGGDGSGQHPSQCLLDMMTIHEEFGHFDGLKVVICGDLRHSRVAKSNMQLLKRLGAQ
LYFAGPEEWFTAEFNDYGQHVALDSILDQVDVVMLLRIQHERFDSAETMTDEAFHVKYGL
TAQRAAQLKASTIWLHPAPVNRDVEIADELVEAPQSRIFKQMHNGVFMRMAMIEYLLKQK
NLIKD
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgactaatcaaacggcgattgtatctgttgaacaactaacaaattcatctgttttaaat
ttaattgaacgggcagaagcctttaaacaaggtgcgacttgcgaattaacgcgtcccgta
tacgcgatgaacctcttttttgaaaatagcactcgaaccaaaacgagttttgaaatggcc
gaacgcaagctcggattatcagtaatgtcttttgaagccgaaaccagttcagtttcaaaa
ggagagacactcagcgatacacttaagacggtccaagcaatcggcgtcgattttgtcgct
gttcgtcatccgcaaaactactactacgacgatttactcgccgatccagcctttcactta
gccttggctaacggtggggatggcagtggtcaacatccatcacaatgtctactcgatatg
atgaccattcatgaagagttcgggcacttcgacggtttgaaagtcgttatctgcggtgat
ttacgccactcacgagttgctaaatctaacatgcaacttttaaaacgactgggcgcacaa
ctctacttcgccggtcctgaagaatggtttacggctgaattcaacgattacggtcaacac
gtcgccctcgatagcatcttagatcaagtcgatgtggtcatgttactcagaattcaacac
gaacgctttgattcagccgaaacaatgaccgacgaagccttccacgttaaatacggccta
acagcacaaagggccgcccaattaaaagcaagtactatctggttacacccagcaccagtt
aaccgcgacgttgaaatcgccgatgaattagtcgaagcaccccaatcacgaatttttaag
cagatgcataacggggtcttcatgcgcatggcaatgattgaatacttattaaaacaaaaa
aatctcattaaagattag

DBGET integrated database retrieval system