KEGG   Lactobacillus sakei: LSA1053Help
Entry
LSA1053           CDS       T00299                                 

Definition
cinnamoyl-CoA reductase (oxidoreductase)
Orthology
K00091  
dihydroflavonol-4-reductase [EC:1.1.1.219]
Organism
lsa  Lactobacillus sakei
Brite
Enzymes [BR:lsa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.219  dihydrokaempferol 4-reductase
     LSA1053
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1047385..1048413)
Genome map
AA seq 342 aa AA seqDB search
MKELVLVTGGSGFIASHIILQLLEQGYAVRTTVRSMAKSQRIVTSMQANGITNIEDLSFI
KADLQHPEQWPAAMVGVSYVMHVASPTPKLNFKDESEMINPAVNGVLMVLKAARDANVKR
VVLTSAYGAICAGHPNQQTPYTEADWSDLSAKNIHPYQKSKTLAEQAAWNFIKTEGQGLS
LAAVNPVGVMGPVLSSVYSHSNVQVEQLLNGQVKAVPQVKSGYVDVRDVASLHLLAMTAP
QADGERFLATTGETLSMLEVADVLRDAFPQYASRLPQKTIPNSVIKLAATFKPDLRMLAT
LVGKYADTSNEKAKKLLGWQQRSAADSIIATGQSMIDLGIIK
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaattagtattagtaactggtggtagtggttttattgcatcacatattatttta
caattattagaacagggctacgccgttcggacaacggtgcgttcaatggccaagagccaa
cggattgtcaccagcatgcaagcaaacgggattaccaatattgaagatttatcgttcata
aaagccgacttgcaacatccagagcaatggccggctgcgatggttggggtcagttacgtc
atgcatgtggcctcaccaacgcctaaattaaatttcaaggatgaatctgaaatgattaat
ccggcagtgaatggtgtcttaatggttttaaaagccgctcgcgatgcgaatgttaagcgc
gtcgtgttaacctctgcatatggggcaatctgtgcggggcatcctaatcaacaaacgcct
tacactgaagccgactggtcagatttaagtgctaaaaatattcatccttatcaaaaatca
aaaacgttagctgaacaggcggcctggaacttcattaaaactgaagggcaaggcttatca
ctagcagctgtcaacccggttggtgttatgggccctgttttatcatccgtttattcgcat
tcaaacgtgcaagttgaacaactgttaaatggccaagttaaggctgtgccacaagtaaaa
tcagggtacgtcgatgtccgcgatgttgcgagcttacacctattagcgatgactgcgcca
caagcagatggcgaacgcttcttagcaaccactggtgaaacattatctatgttagaagtg
gccgatgtcttacgtgatgctttcccacaatacgcaagtcggttaccgcaaaagacaatt
cccaatagtgttattaagctagcagcgacattcaaaccggatttacgaatgttagcgact
ttagtgggtaaatacgccgatacaagtaatgaaaaagctaaaaagcttttaggttggcaa
caaagatcggcagcagattcgattattgcaaccggtcaatcgatgatcgatttaggtatt
attaaataa

DBGET integrated database retrieval system