KEGG   Lactobacillus sakei: LSA1139Help
Entry
LSA1139           CDS       T00299                                 

Definition
UDP-N-acetylmuramyl peptide synthetase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
lsa  Lactobacillus sakei
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:lsa00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    LSA1139
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    LSA1139
Enzymes [BR:lsa01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     LSA1139
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1126340..1127689
Genome map
AA seq 449 aa AA seqDB search
MTIKSSFATTTGRFSYWFLHTFMKGGSSLPGQIATNLDPAVLKNLTKNYDVIIITGTNGK
TLTTALTVQTLKQKYDNIMTNSTGSNMMQGITTAFLAHHPKKGQKQLAILEVDEANVEPL
CRYVEPKAIVMTNIFRDQMDRFGEIYTTYNKILAGVKLVPNTTLIMNGDVPLFSSVELPN
PKIYYGFNHQPDGEMLAPSNTDGVLCPVCQHIIHYKFISYSSQGKFYCPNCGFKRPELTD
QVTAVNEMRPTSSQFEINQAPFEISIGGMYNIYNALAAYSVGRFLDVPVSDIQKPFTQNK
KVFGRQEVIQLKDKAVTLVLVKNPVGLNQVLQMISSDPEDFSLAMLLNANYADGIDTSWI
WDGEFEDLLKHHIPTVITGGERRDDITFRLKVAGVTDEQLHETADLDATLAAIEAAPTKH
VYVLATYTAVLQLRKKMAEANYIKKGLSV
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
atgacaattaaaagttcatttgcaacaacaacgggacgtttttcatactggttcttacat
acctttatgaaaggcggcagctctttacctggtcagattgcaacaaatctagaccccgct
gttttgaaaaacttaactaaaaactacgacgtgattatcatcactgggactaatggtaaa
acgttgacgacggctttgacggttcaaacgctcaagcaaaaatacgacaacatcatgacc
aattcaacaggatcaaacatgatgcaaggaattacgacggcctttttggcccatcatcct
aaaaaaggtcaaaaacaacttgcaattcttgaagttgacgaagccaacgtcgaaccactt
tgccgctacgttgaacctaaggcaattgtgatgactaacatctttagagatcaaatggat
cgttttggtgaaatttataccacttataataagattttggctggcgttaagctcgtgcct
aatacaaccttaattatgaatggtgatgtgccacttttctcatcggttgaattacctaat
cctaaaatttactacggttttaatcatcaaccagatggcgaaatgcttgcaccaagcaat
acggatggcgttttgtgccctgtttgccaacatatcattcactacaagttcatcagttat
agtagccaaggcaaattctactgcccaaattgcggcttcaaacgccctgaactaacggat
caagtgacggccgtcaacgaaatgcgcccaacaagttctcaatttgaaattaaccaagcc
ccttttgaaatctcaatcggtggtatgtacaacatctataatgctctcgcagcttacagc
gttggccgcttcttggatgtccctgtttcggatattcaaaaacccttcacgcaaaataaa
aaagtcttcggtcgccaagaagtgattcaattgaaggacaaggcggtcacattggtgctt
gttaaaaacccagttggcttaaaccaagtcctccaaatgattagctctgatccagaagat
ttctcattggcaatgttactgaacgctaactacgctgatggtattgatacaagttggatt
tgggacggtgaattcgaagacctcttgaaacaccacattccaacggttatcaccggtggc
gaacggcgtgatgatatcactttccgcttgaaagtggctggcgttactgacgaacaacta
cacgaaacagccgacttagatgcgacattagcagcgattgaagcagcccctacgaaacat
gtttacgtacttgctacctacacggcagtcttgcaattacgtaaaaaaatggcagaggcc
aactacattaagaaaggactgtcagtatga

DBGET integrated database retrieval system