KEGG   Lactobacillus sakei: LSA1169Help
Entry
LSA1169           CDS       T00299                                 

Definition
6-phospho-beta-glucosidase (EC:3.2.1.21)
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
lsa  Lactobacillus sakei
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:lsa00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LSA1169
Enzymes [BR:lsa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     LSA1169
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1154400..1155773)
Genome map
AA seq 457 aa AA seqDB search
MIKFPEYFMWGAATSAPQSEGYALNYGKSASTWDKWFEMHPEKFNGDQGPDSASDTYRLY
KEDVQNMQKIGLNSFRTSIAWTRLMPDGEHVNPEAVAFYRDYFERLKAANITPIINLFHF
DMPWWLMEKGGWENRESVMAFARYAKTAFELFGDLVDRWTTFNEPIVHIECGYLTGYHYP
DIIDFKKAVQVGYHTLLAHAAAVAEFRKVKPDGQIGIILNITPAYAKSDAPADLAAKEKA
DLLLAKSFLEPTVLGQVPPALITLLAEHQLTPVTEVGDRDLLAANRVDFIGVNYYQPLRV
QAPTNPHFPALTTDDLYENYVWPERRINPYRGWEIYPEALYDVAMMMKNDYQNIPWYVSE
NGMGVADEERFMAADGEIQDDYRIEFMQEHLRQLHRAIADGSSCFGYHTWTFNDCWSWLN
GFRNRYGFFRVDLEHNAQRTMKKSGHWYRQLTENNGF
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atgatcaaatttccggaatattttatgtggggcgcagccacgtcagcaccccaatcagaa
ggctatgcgcttaattatggtaagtcggcctcaacatgggacaaatggtttgaaatgcac
cctgagaagtttaatggcgaccagggccccgattcagccagtgacacttaccgattgtac
aaagaagacgttcaaaatatgcaaaagattggtttgaattcattcaggacctcaattgct
tggacccgcctaatgccagacggggaacatgttaatccggaagcggtcgctttttaccga
gattattttgaacgtttgaaggctgctaatattacaccaatcatcaatttattccatttt
gacatgccttggtggttaatggaaaagggtggatgggaaaaccgagaatcagtaatggcc
tttgcgcgatatgccaaaacagcatttgaattatttggtgatttggtggaccgttggacg
acttttaatgaaccaatcgttcatattgaatgtggttatttaacgggttaccattatcca
gacatcattgatttcaagaaggcagttcaagttggctaccatactttgttggcacacgct
gcggcggttgctgaatttagaaaagtaaaaccagacggtcaaattggaattattctcaat
attacaccagcttatgcgaagagtgatgcgccagcagacttggcagctaaagaaaaagcg
gatttacttttggctaagagtttcttagaaccaacagttttaggccaggtgccacctgct
ttgataacgttgttggcggaacaccaattgacgcctgttactgaagtcggtgaccgagat
ttattagcggctaaccgtgttgatttcattggtgttaattattaccaaccattgcgagta
caggcaccaaccaatccacacttcccggcgttgacgaccgatgacctctatgagaattac
gtctggccagaacggcgaattaatccatatcgtggctgggaaatctatccagaagccttg
tatgatgttgcgatgatgatgaagaacgactaccagaatattccatggtatgtttctgaa
aacggcatgggtgtcgcagatgaagaacggtttatggctgcagacggtgagattcaagat
gactatcggattgaatttatgcaggaacatttacgccaattacaccgagcgattgcagat
ggtagtagttgctttggctaccatacttggacgtttaatgattgttggtcttggttaaac
gggtttagaaatcgctatggtttcttccgggttgatctggagcataatgcacaacggact
atgaagaaaagtggtcattggtatcgtcaattaacggaaaataatgggttctaa

DBGET integrated database retrieval system