KEGG   Lactobacillus sakei: LSA1329Help
Entry
LSA1329           CDS       T00299                                 

Gene name
glk
Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
lsa  Lactobacillus sakei
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:lsa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LSA1329 (glk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LSA1329 (glk)
   00052 Galactose metabolism
    LSA1329 (glk)
   00500 Starch and sucrose metabolism
    LSA1329 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    LSA1329 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    LSA1329 (glk)
   00524 Butirosin and neomycin biosynthesis
    LSA1329 (glk)
Enzymes [BR:lsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     LSA1329 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1298719..1299690)
Genome map
AA seq 323 aa AA seqDB search
MTDKKLIGVDLGGTTAKFAIMTVDGDIQQRWSIDTDILDEGSHIVPDIVESINHHLDLYN
MTPEDFIGIGMGSPGSVNSEEGTVIGAFNLNWKVTQYLRRDIEAGTRMKLAVDNDANVAA
LGERWKGAGENQPDVAFVTLGTGVGGGIVADGHLLHGVAGSAGELGHVTVEPRGYECTCG
KKGCLETYASATGVVRVARDMAEEYAGNSKLKTMLDDGEQISSKLVFDLAKESDPLAVKV
VDRVSYYLGLALANVGNMLNPAYIVIGGGVSAAGEFLRKQVEAYFEEFTFPNVKQTTKVR
LANLGNVAGVIGAASLALQFDQQ
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgacagacaagaagttaatcggcgttgacttaggtggtacaacggctaaatttgcaatt
atgacagtggatggcgacattcaacaacgttggagtatcgatacagatattttagatgaa
ggtagccacattgtgcccgatatcgttgaatcgattaatcatcatttagatttatacaac
atgacaccagaagatttcatcggaatcggtatgggatcacctggtagtgttaacagtgaa
gaaggtactgttattggtgccttcaacttaaactggaaagtaacgcaatacttacgtcgc
gatattgaagctggcacacgtatgaaactagcagttgataatgatgccaatgtagccgct
ttaggcgaacgctggaagggtgctggtgaaaaccaacctgacgttgctttcgtgacactt
ggtactggtgtcggtggcgggatcgttgctgatggtcatttactacacggtgttgctggt
tctgccggtgaattaggtcacgtgactgttgaaccacgcggttacgaatgtacttgtggt
aaaaaaggttgtttagaaacttatgcttcagcaacaggtgttgtgcgtgttgcgcgtgac
atggctgaagaatatgctggtaattcaaaattgaagacaatgttagatgatggcgaacaa
atcagttcaaaacttgttttcgacttggctaaggaatcagatcctttggctgtcaaagtg
gttgaccgcgtgtcatactaccttggtttagctttagctaacgttggtaacatgttgaac
ccagcctacatcgttatcggtggtggtgtttcagctgctggtgaattcttacgtaaacaa
gttgaagcttactttgaagaatttacattcccaaatgttaagcaaacaacgaaggttcgt
ttagctaacttaggtaacgttgccggtgttatcggtgctgcttcattagctttacaattt
gaccaacaataa

DBGET integrated database retrieval system