KEGG   Lactobacillus sakei: LSA1364Help
Entry
LSA1364           CDS       T00299                                 

Definition
zinc-containing alcohol dehydrogenase (oxidoreductase)
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
lsa  Lactobacillus sakei
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:lsa00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    LSA1364
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LSA1364
  Lipid metabolism
   00071 Fatty acid degradation
    LSA1364
  Amino acid metabolism
   00350 Tyrosine metabolism
    LSA1364
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    LSA1364
   00626 Naphthalene degradation
    LSA1364
Enzymes [BR:lsa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     LSA1364
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1334031..1335026
Genome map
AA seq 331 aa AA seqDB search
MVAYQALVLTHDNETVTAQYATKLTPDLPKEGVLIKVAYSDINYKDRLTMNAKSGVLKNY
PATPGVDFVGTVVTSDNPFFEAGECVLCTGYGTGISIDGGYAQYVKVPSEWLLKCPIELT
PQETMQLGTAGFTAAIALTKILRQPFTRNHDTPLLITGATGGVGSYALTMLAQLGFTNIT
ATTRDLSQTDYLTQLGTKHVIATDDLLTAPLKPLAHQSYTGVIDTLGGDVLAHILPYMAQ
DGLVAACGNAAGFKLATTVFPFILRGVTLVGIDSVNYPRKDRKEIWQLLATNFKPQTWPL
IRNIAFSELATELSTPTKQAGRVVVKIDTEH
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atggtcgcttatcaagctttagttctaacgcacgacaatgaaactgttactgctcagtat
gcaacaaaattgacacctgatttacccaaagaaggcgtcttaatcaaagttgcctattca
gacatcaattataaagaccgcctcacgatgaacgctaaaagtggcgttcttaaaaactat
cccgcaacacccggtgttgattttgttgggaccgtagtcacttcagacaatccttttttt
gaagcaggagaatgtgtcttatgtacaggctacgggactggtattagcatcgacggcggt
tatgcccaatatgtcaaggtccctagcgaatggctcttgaagtgtccaattgaactgaca
ccccaagaaacaatgcaactgggaacagctgggttcaccgcggctatcgcccttactaaa
attcttagacagccttttacacggaatcacgatacaccactactaatcacaggcgcgact
ggtggcgtcggtagctatgcgctcacaatgttagcacaacttggtttcaccaacatcaca
gcgacgacacgcgatctcagtcaaacggattacttaacccaactgggtaccaaacatgtc
attgcaaccgatgacctcttaaccgccccactcaaacccttggcccaccaatcctataca
ggcgtaattgatacacttggcggtgatgtcttagcgcacattctcccttacatggcccaa
gatggtttagtcgcagcttgtggtaacgctgcaggctttaagctcgcaacaacggtcttt
cccttcattttacggggtgtaacgctcgtcgggatcgattcggtcaattatccccggaag
gatcgcaaagaaatctggcagttgttagccactaacttcaaaccgcaaacctggccatta
attcgcaacatcgcattttcagaactcgcaactgaactgagcacccccactaaacaagct
ggtcgcgtggtcgttaaaatcgatactgaacattaa

DBGET integrated database retrieval system