KEGG   Lactobacillus sakei: LSA1412Help
Entry
LSA1412           CDS       T00299                                 

Definition
lipase/esterase
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
lsa  Lactobacillus sakei
Brite
Enzymes [BR:lsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     LSA1412
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1381111..1381869)
Genome map
AA seq 252 aa AA seqDB search
MQYRLPQPYYYDSGPVGVVLLHAYTGSANDVHMMGRFLEKQQISVLAPHFTGHATFEPLD
ILEEGSVQAWWADTTAAIQKLQVAAKKPLFVFGLSLGGLFAMRAIETMPAVIGGGIFSAP
VLEGPTDKLEPLFLGYAQRLYQMAEKTAADQAVQLAKIKQQLPQQLQAIADFSALVTADL
DQIGDKPVFIGQGGQDQVIDPNGASVLKQRLEAQQTPVDYHWYDNAGHVITVDRAHHQLE
TDVEAFIKRYEK
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgcagtatcggttaccacaaccttactattatgatagtggccctgttggcgtggtgtta
ttgcacgcttatacaggaagtgccaatgatgttcatatgatgggccgttttttagagaaa
cagcaaatcagtgtacttgcaccgcattttacggggcatgccacttttgaaccacttgat
atcttagaagaaggtagtgtccaagcttggtgggcggatacaacggctgccattcagaag
ttacaagttgctgccaagaaaccactatttgtttttgggttgtcattgggtggattgttc
gcgatgcgcgcaatcgaaacgatgccagcggtgattggtggtggcatttttagcgcgcca
gtactagaaggaccgactgataaattagaaccgctatttctgggttatgcgcaacgcctt
tatcagatggctgaaaaaacggccgctgatcaagccgttcaattggccaagattaagcaa
cagttaccacaacaactacaagcaatcgctgattttagcgcgttagtcaccgccgattta
gatcagattggtgataagccagtctttatcggtcaaggtggtcaagatcaagtgattgat
cctaatggcgcatcagtattaaaacaacgcttagaagcacaacaaacaccagttgattat
cactggtatgacaatgccggtcacgtgattacagtcgatcgggcacaccaccaattagaa
acagatgttgaagcatttattaaacgttatgagaaataa

DBGET integrated database retrieval system