KEGG   Lactobacillus sakei: LSA1507Help
Entry
LSA1507           CDS       T00299                                 

Gene name
galU
Definition
UTP-glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
lsa  Lactobacillus sakei
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:lsa00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    LSA1507 (galU)
   00052 Galactose metabolism
    LSA1507 (galU)
   00500 Starch and sucrose metabolism
    LSA1507 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    LSA1507 (galU)
Enzymes [BR:lsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     LSA1507 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1475623..1476525)
Genome map
AA seq 300 aa AA seqDB search
MKVRKAVIPAAGLGTRFLPATKAMAKEMLPIVDKPTIQFIVEEAKASGIEDILIITGKGK
RPIEDHFDSAPELEQNLKSKNKTKMLKMVNETTDMGVNLYFIRQSHPNGLGDAVRLAKSF
VADEPFVVMLGDDLMEDKVPLSKQLINEYEETHASQLAVMKVPHNEVDKYGVINPENKVK
DDLYNVKNFVEKPDVDKAPSDLAIIGRYLLTPEIFDVLENQKPGLGGEIQLTDAIDELNK
TQRVFAHEFKGRRYDVGNKFGYLETSIEYGLKHPEVKDDLKKYIIKLGEELKQSEKKENK
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtacgtaaagcagttattccagcagccggtttaggaacacgtttcttaccagcc
actaaagcaatggccaaagaaatgttgccaattgttgataaaccaacgatccaatttatc
gttgaagaagcaaaagcttcaggtatcgaagatattttaattattactggtaagggtaaa
cgcccaatcgaagatcacttcgattcagcacctgaactggaacaaaacttgaagtctaaa
aataagacgaagatgttgaagatggtcaatgaaaccactgatatgggtgttaacctttat
ttcattcgccaatcacatcctaacggtttaggggatgccgttcgtcttgcgaagtctttc
gtggctgacgaacctttcgttgtcatgttaggtgatgacttgatggaagataaagtgcca
ttgagcaaacaattaattaacgaatatgaagaaacacacgcctcacaattggctgttatg
aaagtaccacataacgaagttgacaaatatggtgtcattaaccctgaaaacaaggttaaa
gatgatttatacaatgttaagaacttcgttgaaaagccagacgttgataaggcacctagt
gatttagccattattggccgttacttgttaacgccggaaatttttgatgtcctagaaaat
cagaaaccaggccttggtggcgaaattcaattaacagatgctatcgacgaattgaataag
acacaacgcgtcttcgcccatgaattcaagggccgtcgttacgatgttggtaacaagttc
ggttacttagaaacaagtatcgaatacggtttaaaacaccccgaagttaaagatgattta
aagaaatacatcatcaagttgggtgaagaattaaagcaaagcgaaaagaaagaaaataaa
tag

DBGET integrated database retrieval system