KEGG   Lactobacillus sakei: LSA1702Help
Entry
LSA1702           CDS       T00299                                 

Gene name
adhA, adhP
Definition
alcohol dehydrogenase
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
lsa  Lactobacillus sakei
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:lsa00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    LSA1702 (adhA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LSA1702 (adhA)
  Lipid metabolism
   00071 Fatty acid degradation
    LSA1702 (adhA)
  Amino acid metabolism
   00350 Tyrosine metabolism
    LSA1702 (adhA)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    LSA1702 (adhA)
   00626 Naphthalene degradation
    LSA1702 (adhA)
Enzymes [BR:lsa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     LSA1702 (adhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1683922..1684836)
Genome map
AA seq 304 aa AA seqDB search
MEAAVANKEHTVDIIDKKLRPIKANEALVKMEYCGVCHTDLHVKNGDFGEVPGRVLGHCD
YCVNGQETFCRQAQNAGYTVDGGMAEECIVTADYAVKVPEDLDPIAASSITCAGVTTYKA
IKVSDIKPGQWLVIFGMGGLGNLALQYAKNVFNAKVIAVDINDDKLAIAKELGADVIING
KQEDVVARVKEVTGDGAHATVITAVSKVAFNQAVDAVRATGKVVAVGLPVETMDLSIPRL
VLDGIEVIGSLVGTRADLAEAFEFAAEGAVTPIVQTRPLADINDIMTEMAEGKISGRMVI
DFTK
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atggaagcagcggtcgcaaacaaagaacatacagttgatattattgataagaagttacgt
ccaattaaagccaatgaagcgctcgttaagatggaatactgcggtgtttgtcacaccgac
ttgcatgttaaaaatggtgattttggcgaagtacctggccgtgtcttagggcattgtgat
tattgtgtgaatggtcaagaaacattctgtcgccaagcgcaaaatgcaggctatacggtt
gatggtgggatggctgaagaatgtatcgtcaccgctgattacgcagtgaaagtccctgaa
gatttggatccaattgcggccagcagtattacttgtgctggtgtcacaacttacaaagca
attaaggtttcagacatcaaaccaggtcaatggttggttatttttgggatggggggctta
ggcaacttagcgcttcaatatgccaagaatgtcttcaatgctaaagtgattgcagtggat
attaatgatgacaagttagcaattgctaaggaattaggtgctgatgttatcattaatggc
aagcaagaagatgtggtagcccgggttaaagaagtaactggcgatggcgcccacgcaact
gtgattacggctgtttctaaggtcgctttcaaccaagctgtagatgctgtgcgtgcaacg
ggcaaagtggtggctgttggattgcctgttgaaacgatggatctttcaattccaagatta
gtattagatgggattgaagtcatcggctcacttgttgggacacgggctgatttagcggaa
gcttttgagtttgctgcagaaggcgcagtgacaccaattgttcaaaccagacccttggca
gatatcaatgatattatgactgaaatggctgaaggtaagatttcaggccgaatggtgatt
gattttacaaaataa

DBGET integrated database retrieval system