KEGG   Lactobacillus sakei: LSA1710Help
Entry
LSA1710           CDS       T00299                                 

Gene name
lacM
Definition
beta-galactosidase, small subunit (EC:3.2.1.23)
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
lsa  Lactobacillus sakei
Pathway
Galactose metabolism
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lsa00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    LSA1710 (lacM)
  Lipid metabolism
   00600 Sphingolipid metabolism
    LSA1710 (lacM)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    LSA1710 (lacM)
Enzymes [BR:lsa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     LSA1710 (lacM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1694341..1695297)
Genome map
AA seq 318 aa AA seqDB search
MANTNKRLAVIFGDVTLGLKGPDFHYLFSYQTGGPESLRIQGKEWLYRSPKPTFWRATTD
NDRGNQFPLKSGMWLAADQFIACQSITVAIDGQTIPLPIAPENNRYSGQETAQEVTATYT
YQTITTPQTTVEVSYTIQASGKIRVAVTYHGQAGLPSLPVFGLRFVMPTPATRFIYQGLS
GETYPDRMAGGMAGEYEVTGLPVTPYLVPQDCGVHMATDWVTIYRQAVLDNRLREPVETG
LKFKAVDQPFAFSCLPYTAEELENATHHSELPAPHRTVLSLLGAVRGVGGIDSWGSDVEA
AYQIDATQDHHLEFEISF
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atggcgaacacaaataaacgcttagcagtgatcttcggagatgtgactttaggacttaaa
ggccctgactttcactacctcttttcgtaccaaacgggtgggccagaatcattgcggatt
caaggtaaagaatggctatatcgctcaccaaaaccgactttttggcgggcaactaccgat
aatgatcgcggcaaccaattcccattgaaatcgggaatgtggctagctgctgatcagttc
attgcttgtcagtcgattacagtggcgattgacgggcaaacgattccgctgccaattgcg
cccgagaacaaccgctatagtggtcaggaaacggcccaagaagtgacggctacgtatacc
tatcaaacaattacgacgccgcagacgacggtagaagtcagttatacgattcaagccagt
ggtaaaatccgtgtagcggtgacttatcatggtcaagctggattaccatcattaccagtc
tttggtttacgctttgtcatgccaaccccagcgacgcgctttatttatcaagggttgtca
ggggaaacttatccagatcgaatggctggtggaatggctggtgagtacgaagtcaccggg
ctacctgtgacgccttatctagtaccacaagattgtggtgtgcacatggcaaccgattgg
gtaacgatttatcggcaagcggttctggataatcgtttgcgcgaaccagtcgaaaccggc
ttgaagttcaaggcggtcgatcaaccatttgccttttcatgcttgccatataccgctgaa
gaattggaaaatgcgacccatcattcagaactacccgcaccacaccgaacagtcttaagt
ctcttaggggccgttcgtggcgtgggcggtatcgatagttggggcagcgacgtagaagcg
gcctatcaaatcgatgcgacgcaggatcatcatttggaatttgaaatttcgttttaa

DBGET integrated database retrieval system