KEGG   Lactobacillus sakei: LSA1788Help
Entry
LSA1788           CDS       T00299                                 

Definition
phage-related 1,4-beta-N-acetyl muramidase (cell wall hydrolase) (EC:3.2.1.17)
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
lsa  Lactobacillus sakei
Brite
Enzymes [BR:lsa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     LSA1788
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1772421..1773179)
Genome map
AA seq 252 aa AA seqDB search
MYAANQTGSSGAVTHTIINENNNHALGDLIKQNGPASFADESGISAAETGRPAKDFIDIS
SNNGSISKDEFQLMKNQYGIKGVIVKLTEGDSYCNPLAPEQIANAQAAGLKVSVYHFSWF
ANPQEAAEEATYFMNYAKELELAQNTSFVNDYESVNSPNATSNALKFADTLKAAGFKNVY
HYSSKSWFSSVLDMTKLGAKTCWVAEWPLNPSNDQLLHTGNASWQWASDLYFPELGRTRQ
FDISTDYLNAFS
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
gtgtatgctgctaaccagactggcagttcaggtgccgtaacgcacactattattaatgag
aataataatcatgcgctgggtgatttgatcaaacaaaatggcccagcgtcttttgccgat
gaatcagggatctcagcggctgaaactggtcgtccggcgaaagattttattgatatttcg
agtaataatggcagcatctcaaaagatgaattccaattaatgaagaatcaatacgggatt
aaaggcgtcatcgttaaattaacggagggggattcttactgcaatcccttagcccctgaa
cagattgcaaatgcccaggcagccgggttaaaagtgagtgtctaccattttagttggttc
gctaatccccaagaagctgcggaagaggccacttactttatgaactatgccaaagaattg
gagttagcgcaaaatacatcttttgtgaatgattacgaatcagttaacagtccgaatgcg
actagcaatgctttgaaattcgccgacactttaaaagcggccggttttaaaaatgtctat
cattattcctctaaatcgtggttttcttcagtgttggatatgactaaattgggcgcaaag
acctgctgggtcgctgaatggcccctgaacccttctaatgaccaattattacacactggc
aatgcttcttggcaatgggctagtgacttatattttccagaattaggtcgtactcgccag
tttgatatcagtacggattatttaaacgcttttagttaa

DBGET integrated database retrieval system