KEGG   Listeria seeligeri: lse_0167Help
Entry
lse_0167          CDS       T01184                                 

Gene name
ispE
Definition
4-cytidine 5-diphospho-2-C-methyl-D-erythritol kinase
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
lsg  Listeria seeligeri
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:lsg00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
169282..170160
Genome map
AA seq 292 aa AA seqDB search
MKISITAPAKINLSLDALYKRDDGYHEVEMVMTTIDLADRLYIERLDEDVIVLDVKAHFI
PEDRRNLIYQAAALLKKRFDVKAGVRITIDKHIPVSAGLAGGSSDAAAALKGLNIIWELG
LSINELAEISSEIGSDIAFCVYGGTAIATGRGEKITSLPNMPGCWIVLAKPSISVSTPTI
YKELQVDNVEHPDTKKMIESIEQGDLDGIFAATGNVLESVTLEKNPQVKRIKDRMIAFGA
EAALMSGSGPTVFALIKQYSRAKRVYNGLRGFCEEVYMVRPWSESENDTIKG
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgaaaataagcataacggcgccagctaaaattaatctttcgcttgatgcgctttataaa
cgtgacgatggttatcatgaagtagaaatggtaatgacaactatcgatcttgcggataga
ctttatatagagcggctagatgaggacgttattgtgttagatgttaaagcgcattttatt
ccagaagatcggcgcaatttaatttatcaagcagccgcacttttgaaaaaacgctttgat
gttaaagctggggtccgaattactatagataaacatattccggtttccgcggggcttgca
ggtggcagttctgatgcagccgcagcacttaaaggattgaatattatctgggagcttggt
ctttcaatcaatgaattagcagaaattagctcagaaattggttctgatattgccttttgt
gtttatggtggaaccgcaattgcaactggtcgtggggaaaaaataacctcgcttccgaac
atgccaggttgctggattgtacttgctaaacctagtattagtgtatcaaccccaactatt
tataaagaactacaagtagataatgtagaacaccctgatacgaaaaaaatgatagaatct
attgaacaaggcgatttagacgggatttttgccgccacaggaaacgtccttgaatctgtc
acacttgaaaaaaatccgcaagtaaagcgaattaaagaccggatgattgcgtttggtgct
gaggcggctttaatgagcggtagcggcccgacagtgtttgcgctcatcaaacagtattca
agagcgaaacgtgtctacaacggcttgcggggcttttgtgaggaagtctatatggttaga
ccatggagtgaaagcgaaaacgatactattaaaggttga

DBGET integrated database retrieval system