KEGG   Listeria seeligeri: lse_0296Help
Entry
lse_0296          CDS       T01184                                 

Gene name
tpiA
Definition
(RefSeq) hypothetical protein
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
lsg  Listeria seeligeri
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:lsg00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    lse_0296 (tpiA)
   01230 Biosynthesis of amino acids
    lse_0296 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    lse_0296 (tpiA)
   00051 Fructose and mannose metabolism
    lse_0296 (tpiA)
   00562 Inositol phosphate metabolism
    lse_0296 (tpiA)
Enzymes [BR:lsg01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     lse_0296 (tpiA)
Exosome [BR:lsg04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   lse_0296 (tpiA)
  Exosomal proteins of bladder cancer cells
   lse_0296 (tpiA)
  Exosomal proteins of melanoma cells
   lse_0296 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(324400..325164)
Genome map
AA seq 254 aa AA seqDB search
MRKPLVGINMKNYINTRKETANWLESTIPLLENFSDVDTFIFPSMGTLETTATILAGKSF
GFGPQNMAPEKSGPLTGEFSVESIIDLKANYVEIGHAERKNIFHEEASQIAKKIKLALDE
QITPVVCIGEQVKATTTVDLKDALKKQIDALFQMIALSDWQKIVLAYEPEWAIGKASSAD
TNYIETAHQALRDIIRETGGNEKLVRIIYGGSVSKENAADIVRQKNVDGLFVGRFGHKPQ
NFADIVAIVSQMKG
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgcgcaaacctttagtcggaattaatatgaaaaattatattaacactcgaaaagaaaca
gctaactggctagaatcgactatcccgctactcgaaaatttttctgatgtcgatacgttc
atttttccttcgatgggcactttagaaacaactgcaaccattttagccggaaaatcattt
gggtttggtccgcaaaatatggcgccggagaaatccggcccccttactggggaattttcc
gtcgagtcaattattgatttaaaagcaaactatgtcgaaattggtcacgcagaacggaaa
aacatttttcatgaagaagcgagccaaatcgcaaaaaaaatcaaacttgctttagatgag
cagattacgcccgttgtatgtatcggggaacaagtaaaagcgacaactacagtcgattta
aaagatgcactcaaaaaacaaattgacgctttattccaaatgattgctttatccgattgg
caaaaaattgttttagcttatgaaccagaatgggcaattggaaaagcttcatctgcggat
acgaattacatcgaaaccgcgcaccaagctttgcgagacattattcgcgaaactggtggt
aacgaaaaacttgtaagaattatttacggcggatctgtcagcaaagaaaatgctgcagat
attgttcgtcaaaaaaatgtagatggcttatttgttgggagatttggtcataaacctcaa
aacttcgcagatattgttgctatcgttagccaaatgaaaggatga

DBGET integrated database retrieval system