KEGG   Listeria seeligeri: lse_0475Help
Entry
lse_0475          CDS       T01184                                 

Gene name
hisD
Definition
hypothetical protein
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
lsg  Listeria seeligeri
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:lsg01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:lsg00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(502852..504135)
Genome map
AA seq 427 aa AA seqDB search
MKYLTGTTEAILSELKSIKSTTDTATIETQVKAIIQQVKTDGDKAVLHFTEQFDKVSLSE
LRVSDDEITTALNQVDAPFLEVLQQAKANIESFHLKQKQNAFLDNEKTGVIRGQLIRPLA
TVGVYVPGGTAAYPSSVLMNVLPAKIAGVERIVMITPPGENGINSHVLAAAQIAGVDEIY
QVGGAQGIAALAYGTESIPKVDKIVGPGNIYVATAKREVFGLVDIDMIAGPSEIVVLADD
SANPSFIAADLLSQAEHDTLSRAILITTSEKIAKETETQIYAQLEKLPRKAIAAESIRSE
GKIILAQNQADMFEIMNEIAPEHLEVQLESPMNYLHEIKNAGSIFLGSYASEPLGDYFAG
PNHVLPTSGTAKFFSPLGVEDFTKRSSFISYTKEALAKEKDAIILLAKKEGLDAHAKAIQ
IRFEEEK
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgaagtatttaacaggaactacggaagctattttgagtgaattaaagtctatcaagtcc
accactgataccgcaactatcgaaacacaggtgaaagcaattatccaacaagtaaaaaca
gacggcgacaaggcagttctccacttcacagaacaatttgacaaagtttccctttccgaa
ttacgtgtgagcgatgacgaaatcacaacagccttgaatcaagtcgatgctccctttcta
gaagtgctgcaacaagcaaaagcaaacattgaaagctttcatttgaagcaaaaacaaaat
gcctttttagataatgaaaaaactggtgtgattcgcgggcaacttattcgtcctttagca
actgttggtgtctatgttccaggtggcacagcagcctacccatcatccgttttaatgaac
gttctacctgccaaaattgctggggtagagcgcatcgtaatgattaccccgcccggcgaa
aatggcattaattcgcacgtacttgctgcagctcaaattgccggagtggatgagatttat
caagttggcggtgcacaaggaattgccgccttagcttacggaaccgagtccattccaaaa
gtagataaaatcgtcggtccgggaaatatttatgtagctacagcgaaacgagaagttttt
gggctagtagatattgatatgattgccggaccatctgaaatcgtcgtgctcgctgatgat
tcagcaaacccatcattcatcgcagccgacttactctcccaggcagagcacgatacatta
tctcgcgctattctaatcacaactagtgaaaagatcgccaaagaaactgaaactcaaatt
tacgctcaactagaaaagcttcctcgaaaagccattgcagccgaatcaatccgctcagaa
ggaaaaatcattctcgcccaaaaccaagcagatatgttcgaaattatgaatgaaatagcc
ccagagcatttagaagtacaattagaaagcccgatgaattatttacacgaaattaaaaac
gctggctcgattttcctaggaagttatgcttctgaaccgcttggagactactttgctggg
ccaaaccacgtgttaccgacaagcggaacagcgaagtttttctccccactcggcgtagaa
gatttcacgaagcgctcttcctttatttcttatacaaaagaagcattagccaaagaaaaa
gacgccattattttactcgctaaaaaagaaggcttagatgcacacgccaaagcaattcaa
attcgttttgaggaggaaaagtaa

DBGET integrated database retrieval system