KEGG   Listeria seeligeri: lse_0948Help
Entry
lse_0948          CDS       T01184                                 

Gene name
pdhC
Definition
(GenBank) dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
lsg  Listeria seeligeri
Pathway
lsg00010  Glycolysis / Gluconeogenesis
lsg00020  Citrate cycle (TCA cycle)
lsg00620  Pyruvate metabolism
lsg01100  Metabolic pathways
lsg01110  Biosynthesis of secondary metabolites
lsg01120  Microbial metabolism in diverse environments
lsg01130  Biosynthesis of antibiotics
lsg01200  Carbon metabolism
Module
lsg_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:lsg00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    lse_0948 (pdhC)
   00020 Citrate cycle (TCA cycle)
    lse_0948 (pdhC)
   00620 Pyruvate metabolism
    lse_0948 (pdhC)
Enzymes [BR:lsg01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     lse_0948 (pdhC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl Biotin_lipoyl_2 E3_binding HlyD_3 NQRA RnfC_N GCV_H HlyD_D23 DUF896
Motif
Other DBs
NCBI-ProteinID: CBH27099
Position
990484..992118
Genome map
AA seq 544 aa AA seqDB search
MAYSFKLPDIGEGIHEGEIVKWFVQPGDKIEEDESLFEVQNDKSVEEITSPVSGTIKEIK
VAEGTVATVGQVLVTFDGVEGHEDDAEEESAAPKAENTESVPAPAKTAGKGIFEFKLPDI
GEGIHEGEIVKWFIQPGDKVEEDQSIFEVQNDKSVEEITSPVDGTVKDILVSEGTVATVG
QVLVTFEGDFEGEASHESTPESPAEDAALANNDATSAPATGGNGTPSSQKDPNGLVIAMP
SVRKYAREKGVNIAEVAGSGKNNRVVKADIDAFLNGEQPVAATTTANAEDKASAPKTEKA
AAKPAVASSDAYPETREKLTPTRRAIAKAMVNSKHTAPHVTLMDEIEVTALMAHRKRFKE
VAAEKGIKLTFLPYMVKALVATLRDFPVLNTTLDDATEELVYKHYFNVGIAADTDHGLYV
PVIKNADKKSVFAISDEINELAGKARDGKLTADEMRHGSATISNIGSAGGQWFTPVINYP
EVAILGVGRIAQKPIVKDGEIVAAPVLALSLSFDHRVIDGATAQKAMNNIKRLLNDPELL
LMEV
NT seq 1635 nt NT seq  +upstreamnt  +downstreamnt
atggcatattcatttaaattaccggatatcggtgaaggtatccatgaaggtgaaatcgtt
aaatggtttgtacaaccaggcgataaaattgaagaagatgaatccctatttgaagtacaa
aacgacaaatcagtggaagaaatcacttctccagtttccggaacaattaaagaaatcaaa
gttgctgaaggtaccgttgcaacagttggacaagtactagtaacatttgatggcgtagaa
ggtcacgaagacgacgccgaagaagaaagcgcagcaccaaaagcagaaaacacagaatca
gttcctgcaccagcaaagacagctggaaaaggaatttttgaatttaaattaccagacatt
ggtgagggaattcatgaaggcgaaattgttaaatggtttattcaaccgggcgataaagta
gaagaagatcagtccatttttgaagtgcaaaacgacaaatctgtcgaagaaattacttct
ccagtagatggaactgtaaaagatattttagttagtgaaggaacagtagcaacagttggt
caagtattagtaacattcgaaggtgattttgaaggagaagctagtcatgaatctactcca
gaatctccagcagaagacgctgcacttgcaaacaacgatgcaacttccgcaccagcaact
ggcggtaacggaacaccttcatctcaaaaggatcctaatggccttgtaatcgcaatgcct
tccgtacgtaaatatgcacgtgaaaaaggcgttaatattgctgaagtagcaggctctgga
aaaaataaccgcgtagttaaagcggacattgatgctttcctaaatggtgaacaaccagtt
gcagcaactactactgcgaatgcagaagacaaagcatctgctccaaaaacagaaaaagcg
gctgcgaaaccagctgttgcaagttccgatgcttacccagaaacgcgcgaaaaattaaca
ccaactcgtcgtgcaatcgcaaaagcaatggtaaactcaaaacatacagcaccacacgtt
actttaatggacgaaatcgaagtaactgctttaatggctcaccgcaaacgtttcaaagaa
gttgctgccgaaaaaggtatcaaacttactttcttaccttatatggtgaaagctcttgtg
gcaacgcttcgtgacttcccagtgcttaatacaactttagacgatgcaacagaagaactt
gtttacaagcattacttcaacgttggtatcgcagcagacacagatcacggtttgtatgta
ccagtaatcaaaaatgcggataaaaaatctgtatttgctatctctgacgaaatcaatgaa
ctagctggaaaagcacgcgacggtaaattaacagctgacgaaatgcgccatggttccgca
actatttctaatatcggttctgccggcggacaatggttcactccagttattaattaccca
gaagttgctattctaggtgttggtcgtattgcgcaaaaacctatcgtaaaagatggcgaa
attgtagcagcaccagtactagcgctatcattgagctttgatcaccgtgtaattgacgga
gcaactgctcaaaaagcaatgaataatattaaacgtttattaaacgatccagaattatta
ctaatggaggtgtaa

DBGET integrated database retrieval system