KEGG   Listeria seeligeri: lse_1233Help
Entry
lse_1233          CDS       T01184                                 

Gene name
dxr
Definition
hypothetical protein
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
lsg  Listeria seeligeri
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lsg00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    lse_1233 (dxr)
Enzymes [BR:lsg01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     lse_1233 (dxr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1251906..1253048
Genome map
AA seq 380 aa AA seqDB search
MKKIILLGATGSIGTQALTIVRENPDKFQVVALSFGRNMDRGRAIIQEFKPEMVAVWHTR
DKVTLQAEFPDLKVFNGLEGLREVSTYPDGDILLNAVMGSVGLLPTLDAIEAGKTIAIAN
KETLVTAGHLVMNAAREKNISLLPVDSEHSAILQALNGENPEKIKKIILTASGGSFRDKT
REQLSEVTVKEALKHPNWNMGNKLTIDSATMFNKGLEVMEAHWLFGVSYDQIEVVIQRES
IVHSMVQFVDGSIMAQLGTPDMRIPIQYALTAPDRFHIPFENEFRITDFSALHFEKVDYE
RFPALKLAYNAGKIGGTMPTVLNAANEIAVAGFLNGQVAFYNIEALVENAMNRHTSISNP
DLDTILQVDKETRAYVKTLL
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaattattttactgggagcaactggttctataggtactcaagcgttaacgatt
gttcgagaaaatccagataagtttcaagtagtagcgcttagctttgggcgaaatatggat
cgtggtcgagcgattattcaagaatttaagccggaaatggtggctgtttggcatacccgc
gacaaagtaacgctccaagcagaatttcctgatttaaaggtttttaatggtttagaggga
cttagagaagtgtcgacctatccagacggtgatattttactaaatgctgtaatgggaagt
gttggtttgcttccaaccttggatgcaattgaagccggtaaaactatcgcaattgcaaat
aaagaaacactagttacagcagggcatttagttatgaatgcggctcgagagaaaaatatt
tctttattgccagttgatagtgaacattcggctattttacaagcattaaacggagaaaat
cctgaaaaaattaaaaaaataattctaactgcaagcggcgggagttttcgtgataaaacg
cgggaacaattaagtgaagtaactgtgaaagaagcgctgaaacatcctaattggaacatg
ggaaataaattaacgattgattccgcgacgatgtttaacaaaggcttagaagtaatggag
gcgcattggttattcggtgtcagctacgatcaaattgaagtagtcattcaacgagaaagc
atcgtgcattcgatggttcaatttgtggatggtagtatcatggcgcaacttggaactcct
gatatgcgaattcctattcaatatgcgctcaccgcaccagatagatttcatataccgttt
gaaaatgagtttcggattactgatttttctgcgcttcattttgaaaaagtagattatgaa
agatttccggcattgaaactcgcgtataatgctggtaaaataggtggaacaatgccgacc
gttttaaacgcggcaaatgaaattgctgtagcaggctttttgaatgggcaagttgctttt
tataatatagaagcgcttgttgaaaatgcaatgaatcggcatactagtatttcgaaccct
gatttggatactattttgcaggtggataaagaaactcgcgcgtatgtaaagacactttta
tag

DBGET integrated database retrieval system