KEGG   Listeria seeligeri: lse_1255Help
Entry
lse_1255          CDS       T01184                                 

Gene name
glk
Definition
glucokinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
lsg  Listeria seeligeri
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:lsg00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    lse_1255 (glk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    lse_1255 (glk)
   00052 Galactose metabolism
    lse_1255 (glk)
   00500 Starch and sucrose metabolism
    lse_1255 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    lse_1255 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    lse_1255 (glk)
   00524 Butirosin and neomycin biosynthesis
    lse_1255 (glk)
Enzymes [BR:lsg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     lse_1255 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1275698..1276666
Genome map
AA seq 322 aa AA seqDB search
MNKKLIGVDLGGTTAKLAILTKEGEIEEKWTIDTNIDDKGSHIVKDIGDSLNQKLTDLQL
DNDIFYGIGMGTPGTVNYETGTVKGAYNLNWSEEQNVSEDLEKITGLKITLDNDANVAAL
GERWKGAGEGGANVVFVTLGTGVGGGIFAEGKILHGVRGAAGEIGHVTVVPENGYDCTCG
KKGCLETVASATGIVRVAKDLAKKFTGESNLKKMIENDENITSKLIFELGAEGDELAKET
IDKISFYLALALSHIGNMLNPEKIIIGGGVSAAGDQLLTPVRNYFETMVFPAVKESTKLS
IATKGNDAGIIGAAWLALPIED
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaaaaattaattggtgtagatttaggcggaacaacagcaaaattagcaatctta
acaaaagaaggcgagattgaagaaaaatggacaattgatacaaatattgatgacaaagga
tctcatattgtaaaagacattggtgattctcttaatcaaaaattgacagatttacaactt
gataatgatattttttatggcattggaatggggactcctgggactgttaattatgaaaca
ggtacagtaaagggagcttacaatctaaactggtctgaggagcaaaacgttagtgaagat
ttagaaaaaattactggactaaaaataacattagataacgatgctaatgtcgctgcactg
ggtgaacgctggaaaggcgccggtgaaggtggtgcaaatgtagtatttgttactcttgga
acaggcgttggcggcggaatctttgctgaaggaaaaatattgcatggtgttcgtggtgct
gcaggtgaaatcgggcatgtaacagttgttcctgaaaatggttatgattgtacttgtggt
aaaaaagggtgcttagaaaccgtggcatcagcgacaggtattgttcgagtagctaaagac
ttagctaaaaaattcactggcgagtcgaatcttaaaaaaatgatagaaaatgatgagaat
attacttctaaattgatttttgaacttggcgcagaaggtgatgagttggctaaagaaaca
attgataaaatttctttttacttggcacttgcactcagtcatattggtaatatgttaaac
cccgaaaaaattattattggtggcggagtttcagcagcaggcgatcaattattgacacct
gttagaaattattttgaaacaatggtatttcctgcagtaaaagaatctaccaaattatca
attgcgacaaaagggaatgatgcagggataattggagctgcttggttagcattaccaatt
gaagattaa

DBGET integrated database retrieval system