KEGG   Listeria seeligeri: lse_1264Help
Entry
lse_1264          CDS       T01184                                 

Gene name
gcvT
Definition
glycine cleavage system T protein
Orthology
K00605  
aminomethyltransferase [EC:2.1.2.10]
Organism
lsg  Listeria seeligeri
Pathway
Glycine, serine and threonine metabolism
One carbon pool by folate
Metabolic pathways
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:lsg01200]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:lsg00260]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:lsg00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1282252..1283340
Genome map
AA seq 362 aa AA seqDB search
MTELQKTPIHPIYEKYGAKTIDFGGWDLPVQFSGIKAEHEAVRTDVGLFDVSHMGEVLVE
GSDSTAYLQYLLSNDIEKIKIGKAQYNIMCYENGGTVDDLVVYKITETKYILVVNAANTE
KDYEWMVKNVFGNVTVTNVSSMYGQLALQGPNAEKILTKLTDVDLSSISFFGFVEDANVA
GVKTIISRSGYTGEDGFEIYMQSDDAIKVFEAIMAEGVLPIGLGARDTLRLEAVLALYGQ
ELSQDITPLEAGLNFAVKLKKEADFIGKEALVKQKEAGLTRKLVGIELIERGIPRHDYSV
FQNDKKIGIITSGTQSPTLGTNIGLALLETPYTELGQEVEVGIRTKKIKAKVIATPFYKR
AK
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgacggaattacaaaaaacaccaattcatccaatctatgaaaaatatggagctaaaaca
attgactttggtggatgggatttacctgtacaattttctggaataaaagctgaacatgag
gccgtacgaaccgatgtagggctatttgatgtgtcacacatgggagaagttttggtggaa
ggatctgacagtacggcatatttacaatacttgttatcaaatgacatagaaaaaataaaa
ataggtaaggcacaatataatattatgtgctatgaaaacggtgggacagtagacgatttg
gttgtttataaaataacagaaacaaaatacatactagtcgtaaatgcagccaatacggaa
aaagattatgagtggatggtaaagaatgtttttggaaatgttactgttacgaatgtttcc
tctatgtatggacaattagcgcttcaaggcccaaatgctgaaaaaatacttactaaacta
accgatgttgatttaagttccattagtttttttggatttgttgaagacgcaaacgtagct
ggagtaaaaacaattatttctagaagtggttatactggtgaagatggctttgagatttac
atgcaaagtgacgatgctataaaagtttttgaagctattatggcagagggtgttttacca
attggtttaggtgctcgagatacattgcgtttagaagctgtacttgcgctctatggtcaa
gaattaagtcaagatattacgccgcttgaagcaggcttgaactttgcagtgaagctgaaa
aaagaagcggattttatcggaaaagaagcgttggttaaacaaaaagaagcaggtttaacc
cggaaattagttggaattgaattaattgaacgaggaataccacgccatgattattccgtt
tttcaaaatgataaaaaaatcggtataattacttctggtactcaatcgccaactcttgga
acaaatattggtttagcgttacttgaaacaccgtacacagagctcgggcaagaagtagaa
gtgggtattcgaactaaaaaaataaaagcaaaagttatagcaacaccattttataaacgc
gcaaagtaa

DBGET integrated database retrieval system