KEGG   Listeria seeligeri: lse_1469Help
Entry
lse_1469          CDS       T01184                                 

Gene name
hemB
Definition
porphobilinogen synthase
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
lsg  Listeria seeligeri
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lsg00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    lse_1469 (hemB)
Enzymes [BR:lsg01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     lse_1469 (hemB)
Exosome [BR:lsg04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   lse_1469 (hemB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1503015..1503989)
Genome map
AA seq 324 aa AA seqDB search
MKNQFDRHRRLRKTSAMRDLVRETILHTDDLIYPIFVKDGKEPKSEVVSMPGVFQFPLHE
LAEEIVTIQKLGIKAVILFGIPAEKDAVGTQAYHDHGIIQEAIRLIKTKFPKMIVVADTC
LCEFTDHGHCGVIQDGEILNDESLELLQKTAISQAAAGADIIAPSNMMDGFVQIIREGLD
EAGFQDIPIMSYAVKYASAFYGPFRDAAGSAPQFGDRKSYQMDPANREEALREAISDEQE
GADFLIVKPSLSYLDIMRDVKNNTHLPVVAYNVSGEYAMVKAAAQNGWIDEERIVLEMLT
SMKRAGASLIITYFAKDVSKYLNK
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgaagaatcaatttgatagacatcgtcgtttaagaaagactagtgcgatgcgtgattta
gttagagaaaccattttacatacggatgatttaatttatcctatttttgtaaaagatgga
aaagaacccaaatcagaagtggtttcgatgccaggcgtattccaattcccactacatgaa
ttagcagaagaaattgtaacaattcaaaaactaggaataaaagccgtgatattattcggt
atccccgctgaaaaagatgcagttggcacacaagcttatcacgatcacggaattatacaa
gaagcaatccgattaatcaaaacgaaatttccgaagatgattgttgtagcagacacatgt
ctatgcgaatttaccgatcatggtcactgtggtgtcattcaagatggagaaatcttaaat
gatgaatctctggaactgctacaaaaaacagcgattagccaggctgcagcaggagcggat
attattgcaccttctaatatgatggatggatttgtccaaataattcgtgaagggcttgat
gaagctggttttcaagatattccaattatgtcgtatgcagtgaaatatgcctcagctttt
tatgggccatttcgggatgcggccggaagtgcaccacaatttggagatagaaagtcttat
caaatggacccagccaacagagaagaagcattgcgtgaagcaatttctgatgaacaagaa
ggggcagactttttaattgtaaaaccatcactttcttatttagatatcatgcgagatgtt
aaaaacaatacccatttaccagtagttgcttacaatgttagtggtgaatatgctatggta
aaagcagctgctcaaaatggttggattgacgaagaaagaatcgttttagaaatgttgaca
agcatgaaacgtgcgggagcatcacttattatcacttattttgctaaagacgtatccaaa
tacttaaataaatag

DBGET integrated database retrieval system