KEGG   Listeria seeligeri: lse_1486Help
Entry
lse_1486          CDS       T01184                                 

Gene name
pfk
Definition
(GenBank) pfk
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
lsg  Listeria seeligeri
Pathway
lsg00010  Glycolysis / Gluconeogenesis
lsg00030  Pentose phosphate pathway
lsg00051  Fructose and mannose metabolism
lsg00052  Galactose metabolism
lsg00680  Methane metabolism
lsg01100  Metabolic pathways
lsg01110  Biosynthesis of secondary metabolites
lsg01120  Microbial metabolism in diverse environments
lsg01130  Biosynthesis of antibiotics
lsg01200  Carbon metabolism
lsg01230  Biosynthesis of amino acids
lsg03018  RNA degradation
Module
lsg_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:lsg00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    lse_1486 (pfk)
   00030 Pentose phosphate pathway
    lse_1486 (pfk)
   00051 Fructose and mannose metabolism
    lse_1486 (pfk)
   00052 Galactose metabolism
    lse_1486 (pfk)
  Energy metabolism
   00680 Methane metabolism
    lse_1486 (pfk)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    lse_1486 (pfk)
Enzymes [BR:lsg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     lse_1486 (pfk)
Protein phosphatases and associated proteins [BR:lsg01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     lse_1486 (pfk)
Messenger RNA biogenesis [BR:lsg03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     lse_1486 (pfk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase DAGK_cat
Motif
Other DBs
NCBI-ProteinID: CBH27637
Position
complement(1522748..1523707)
Genome map
AA seq 319 aa AA seqDB search
MKRIAILTSGGDAPGMNAATRAVVRKAIYEGLEVYGINYGFLGLVNGDIHKLELGSVGDL
LHRGGTFLYSARYPEFATEEGQLKGIEQLKKHQIDGLVVIGGDGSYHGAEALTNRGFPTI
GVPGTIDNDISGTDFTIGFDTALNTVLDALDKIRDTATSHERTFIIEVMGRDAGDIALWS
GLAGGAEAIIVPEESFNMDDVVDRLNKGRERGKKHSIIVVAEGVMSGNEFAKQLAEYGDY
HARVTVLGHVQRGGSPTAFDRVLASRLGARAVELLLENRGGLAVGIRENRIVENNIGEIL
KEKHTLDQKLFDLASILSI
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgaattgcaattttaacaagtggaggagacgctccaggtatgaatgcagccact
cgtgctgttgtacgtaaagcaatctatgaaggacttgaggtttatggtattaactatggc
tttttaggattagtcaatggggatatccataaattagaattaggttctgttggtgattta
cttcatcgcggtggaacattcctatattcagcaagataccctgaatttgctacagaagaa
ggacaacttaaaggaattgaacaactgaagaaacatcaaattgatggtttagttgttatc
ggtggagacggatcttaccacggagcagaagcgcttacaaatcgtgggttcccaactatt
ggtgtcccaggaactattgataatgatatttctggtactgattttacaattggttttgat
actgcacttaacacagttcttgatgcattagataaaatccgtgatactgctacaagtcat
gaacgtacttttattattgaagtaatgggtcgtgatgctggcgatatcgcactttggtct
ggtcttgctggtggcgctgaagctattatcgttccagaagaaagctttaatatggatgat
gtcgtggatcgcttgaacaaaggtcgcgaacgtggtaaaaaacatagtattatcgtagtt
gcagaaggagttatgtctggtaacgagtttgccaaacaattagctgaatatggtgattat
catgcgcgtgtaactgttctaggacatgttcaacgtggaggaagcccaactgcatttgac
cgtgtgcttgcaagtcgtcttggagcgcgcgcagtagaattattgttagaaaaccgcgga
ggattagctgtaggaatccgtgaaaatagaattgtcgaaaataatattggtgaaattttg
aaagaaaaacacacacttgatcaaaaactctttgatcttgcatctattttgtcgatttaa

DBGET integrated database retrieval system