KEGG   Listeria seeligeri: lse_1548Help
Entry
lse_1548          CDS       T01184                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase alpha subunit (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
lsg  Listeria seeligeri
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:lsg00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    lse_1548 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    lse_1548 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    lse_1548 (trpA)
Enzymes [BR:lsg01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     lse_1548 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
complement(1587599..1588375)
Genome map
AA seq 258 aa AA seqDB search
MTKTLTEKLSSNKEHPAIVTYIMGGDGGLDHLEEQLLFLEKSGVSAIEIGIPFSDPVADG
PVIQLAGLRALKEQVSLEQILTKLASSKVQIPLIIMSYINPIFHLGIPKFVELLKNTPVK
GLIIPDLPYEHQNLISPELERTDIALIPLVSLTSPKERLAEITKHAEGFIYAVTVNGTTG
VRSEFDTHIDTHLAYLKSISPVPVLAGFGVSSIEHVEKFAHVCDGVIIGSKVVQMLHEKK
TTELGDFLKKAANVRIEI
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgactaaaacattaacggaaaaactttcaagtaacaaagaacatccggctattgtcacg
tatattatgggtggagacggtggtttagaccatttagaagaacaattactattcttagaa
aaatcgggtgtaagtgctattgaaatcggtattccattttcagatccagtagcagatggt
cctgttatccaacttgctggtttgcgcgctttgaaagagcaagttagtctagaacaaatt
ttgacgaaattagcatctagtaaagtccaaataccgctgattattatgagttatatcaat
ccgatttttcatttgggaatcccaaaatttgtagaattgctcaaaaatacgcctgtaaaa
ggattgattattccggatttaccatatgagcatcaaaatcttatttctcctgagctagaa
cgaacagacattgcgctaattccgcttgtttccctaacgagtccaaaagagcggcttgca
gaaatcaccaaacatgcggaaggatttatatacgcagtgacagtcaatggaacgaccggt
gttaggagtgaatttgatacgcacatcgacacgcatctagcttatttaaagagtattagt
ccggttcctgtgcttgctggttttggtgtttcttccattgaacatgtggaaaaatttgcg
catgtatgtgacggtgtaattattggtagtaaagtggttcaaatgttacatgaaaaaaag
acaactgagcttggagattttttgaaaaaagcggctaatgttcgaattgaaatataa

DBGET integrated database retrieval system