KEGG   Listeria seeligeri: lse_1549Help
Entry
lse_1549          CDS       T01184                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase, beta subunit (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
lsg  Listeria seeligeri
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:lsg00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    lse_1549 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    lse_1549 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    lse_1549 (trpB)
Enzymes [BR:lsg01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     lse_1549 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
Position
complement(1588368..1589570)
Genome map
AA seq 400 aa AA seqDB search
MTYQAPDENGFYGKFGGRFVPETLMKAVKELEEAYQDSKTDPAFQKELNYYLKEYVGRET
PLYFAEQLTAYAGGAKIYLKREDLNHTGAHKINNTIGQALLARQMGKQKVVAETGAGQHG
VATATVAALFNMECTIFMGEEDVKRQSLNVFRMELLGAKVVSVKAGSRTLKDAVNEALRF
WVANVEDTHYIMGSVLGPHPFPEIVRDYQSVIGTEARKQHLEVEGKLPEAIVACVGGGSN
AMGLFYPFVEDKAVQMHGVEAAGHGLETEFHAATISKGEIGILHGAMMDVLQDENGQILE
AFSISAGLDYPGIGPEHSFFRDIGRAEYHSVTDDEAVEAFQLLCRTEGIIPALESSHAIS
YAVKLAASMRPEESMIVCLSGRGDKDVNQLKERLEGQAND
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgacttatcaagcacctgacgaaaatggcttttatggtaaatttggcggtagatttgta
ccagaaacgttaatgaaagcagtgaaagaattggaagaagcctaccaagattcaaaaaca
gatccagcttttcaaaaagaattaaattactatttaaaagagtatgttggccgggaaacg
ccactttattttgcggaacaattaacggcgtatgctggcggtgcaaaaatttacttaaaa
agggaagatttgaaccatactggagcacataaaattaataacacaattggccaggcgcta
ctagcaagacaaatgggaaaacaaaaagtggtggcagagactggcgcaggacaacacggt
gtcgcaactgcaactgtagcagcgctttttaatatggaatgtactatttttatgggtgaa
gaagatgtgaaacgccagtcgttaaatgtatttagaatggaattgctgggcgcgaaagta
gtaagtgtgaaagctggtagtcgcacgcttaaagatgctgtaaatgaagcattgcgattc
tgggttgcaaatgtggaagatacgcattatattatgggctcagtactagggccacatcca
tttccagaaatcgttcgtgattatcaaagtgtgatcggaacagaagccagaaaacagcat
ttagaagtagaagggaaattaccagaagcgattgttgcttgtgttggtggcggaagtaat
gcaatgggactattctatccatttgtagaagataaagcagtccaaatgcacggcgtcgaa
gcagcaggacacggccttgaaacagaatttcatgctgcaactatttctaaaggagaaatt
ggtattttgcacggggcaatgatggatgtattacaagatgaaaacggacaaattcttgag
gcgttttcgatttcagctgggttagattatccaggaatcggaccagaacacagttttttc
agagatatcggacgagctgagtatcattcggtaaccgacgatgaggcggtagaagccttt
caattgttatgtcggacggaaggaattatcccggcacttgaaagctctcatgcaattagt
tacgcggtaaaattagcagctagtatgcgtccagaagaaagtatgattgtctgtttgtcc
ggtcgtggggataaagatgtaaaccaactaaaagaacgtttggagggtcaagctaatgac
taa

DBGET integrated database retrieval system