KEGG   Listeria seeligeri: lse_1555Help
Entry
lse_1555          CDS       T01184                                 

Definition
bifunctional aldehyde/alcohol dehydrogenase
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
lsg  Listeria seeligeri
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:lsg00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    lse_1555
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    lse_1555
   00620 Pyruvate metabolism
    lse_1555
   00650 Butanoate metabolism
    lse_1555
  Lipid metabolism
   00071 Fatty acid degradation
    lse_1555
  Amino acid metabolism
   00350 Tyrosine metabolism
    lse_1555
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    lse_1555
   00626 Naphthalene degradation
    lse_1555
Enzymes [BR:lsg01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     lse_1555
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     lse_1555
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1594974..1597574
Genome map
AA seq 866 aa AA seqDB search
MAIKENAAQEVLEVQKVIDRLADNGQKALKAFENYDQEQVDNIVHAMALAGLDQHMPLAK
LAVEETGRGLYEDKCIKNIFATEYIWNNIKNNKTVGVINEDVQTGVIEIAEPVGVVAGVT
PVTNPTSTTLFKAIIAIKTRNPIIFAFHPSAQGCSSAAAKVVYDAAIAAGAPEHCIQWVE
KPSLEATKQLMNHEKVALVLATGGAGMVKSAYSTGKPALGVGPGNVPAYIDKTAKIKRSV
NDIILSKSFDQGMICASEQAVIVDKEVAKEVKAEMEANNCYFVKGAEFKKLESYVINPEK
GTLNPDVVGKSPAWIANQAGFKVPEDTKILVAEIKGVGDKYPLSHEKLSPVLAFIEAANQ
AEAFDRCEEMLVYGGLGHSAVIHSTDKEVQKAFGIRMKACRIIVNAPSAQGGIGDIYNGF
IPSLTLGCGSYGKNSVSQNVSATNLLNVKRIADRRNNMQWFKLPPKIFFEKYSTQYLQKM
EGVERVFIVTDPGMVQFKYVDVVIEHLKKRGNDVSYQVFADVEPDPSDVTVYKGAELMKD
FKPDTIIALGGGSAMDAAKGMWLFYEHPEASFFGLKQKFLDIRKRTFKYPKLGGKAKFVA
IPTTSGTGSEVTPFAVITDKENNIKYPLADYELTPDVAIVDAQYVTTVPAHITADTGMDV
LTHAIESYVSVMASDYTRGLSIRAIELVFENLRDSVLKGDPDAREKMHNASALAGMAFAN
AFLGINHSLAHKIGPEFHIPHGRANAILMPHVIRYNALKPKKHALFPRYESFRADEDYAR
ISRIIGFPATTTEEGVKSLVDEIIKLGKDVGIDMSLKGQNVDKKDLDAVVDTLADRAFMD
QCTTANPKQPLVSELKEIYLEAYKGV
NT seq 2601 nt NT seq  +upstreamnt  +downstreamnt
atggcaattaaagaaaatgcggcccaagaagtattagaagttcaaaaagtgattgacaga
ttagcagacaatggacaaaaagcattgaaagcatttgaaaattacgatcaagaacaagta
gacaatatcgtacatgcgatggcgcttgccggacttgaccaacatatgccccttgcaaaa
ttagcagtagaagaaaccggacgtggattatacgaagataaatgtattaaaaacatcttc
gcaacagaatatatttggaacaacattaaaaacaacaaaacagttggtgttattaatgaa
gacgtgcaaacaggcgttatcgaaattgctgaaccagttggtgtggttgccggagttaca
cctgtaacaaaccctacctccactactcttttcaaagcaattatcgctattaaaactcgt
aacccaatcatctttgccttccatccaagcgcacaaggttgttcatctgcagcagcaaaa
gttgtctacgatgcagcaatcgcagctggagcaccagaacattgtattcaatgggtagaa
aaaccttccctagaagcaacaaaacaattaatgaaccatgaaaaagttgccttagttctt
gcaactggtggtgctggaatggttaaatcagcctactcaactggtaaacccgcactaggt
gttggaccaggtaacgtaccagcttacattgacaaaacagctaaaatcaaacgttctgta
aatgacattattctttctaaatcttttgaccaaggtatgatttgtgcttctgagcaagca
gttatcgtggacaaagaagtagccaaagaagtaaaagcagaaatggaagctaacaattgt
tacttcgttaaaggcgctgaattcaagaaattagaaagctacgtaatcaatcctgaaaaa
ggaacacttaacccagatgtagttggtaaatcccctgcctggattgctaaccaagccggt
tttaaagttccagaagatacaaaaattcttgttgctgaaattaaaggtgttggcgacaaa
tatccactatctcatgaaaaacttagcccagttcttgcatttatcgaagcagctaaccaa
gcagaagcattcgatcgttgtgaagaaatgctagtatacggaggacttggacactctgca
gttatccattccactgataaagaagttcaaaaagcatttggtattcgtatgaaagcttgc
cgtatcattgtaaacgcaccaagcgctcaaggcggtatcggtgacatttataacggcttc
atcccttccctaactcttggttgtggatcttatggtaaaaactctgtatcacaaaatgta
agtgcgactaacttgctgaacgttaaacgtatcgcggatcggagaaataatatgcaatgg
ttcaaacttccaccaaaaatcttctttgaaaaatattccactcaataccttcaaaaaatg
gaaggcgttgaacgtgtatttatcgtaactgacccaggaatggttcaattcaaatatgtt
gatgttgtaatcgaacatttgaaaaaacgtggcaacgacgtatcttaccaagtatttgct
gacgttgaaccagatccatctgatgtaactgtttataaaggtgccgaattaatgaaagac
ttcaaacctgatacaattatcgctcttggtggtggttcagcaatggatgctgctaaaggt
atgtggttattctatgaacacccagaagcttctttcttcggactaaaacaaaaattctta
gatatccgtaaacgtactttcaaatatcctaaacttggaggaaaagcgaaatttgttgct
attccaacaacaagtggtactggatctgaggtaactcctttcgcggttattactgataaa
gaaaataacattaaataccctcttgctgactatgaactaactccagacgttgcgattgtt
gatgcacaatacgtaacaactgttccagcacacatcactgctgatactggtatggacgtt
ttaactcatgcaattgaatcttatgtttctgtaatggcaagtgattatactcgtggttta
tctatccgagcaatcgaacttgtatttgaaaacctacgtgattccgttcttaagggtgat
cctgatgcacgcgaaaaaatgcataatgcttctgccctagctggtatggcgtttgccaat
gcgttccttggaattaaccatagtttggcacacaaaatcggacctgaattccacattcct
catggtcgtgcgaatgccatccttatgccacacgttattcgttataacgcacttaaacct
aaaaaacatgcgctattcccaagatatgaaagcttccgtgcagatgaagattatgctcgt
atctctcgtattatcggcttccctgctacaactacagaagaaggcgttaaatcacttgta
gatgaaatcatcaaacttggtaaagatgttggtatcgacatgagtcttaaaggacaaaat
gttgataaaaaagacttggatgctgttgtagatacacttgcagatcgcgcattcatggac
caatgtactactgccaaccctaaacaaccacttgtaagcgaactaaaagaaatctaccta
gaagcttacaaaggtgtatga

DBGET integrated database retrieval system