KEGG   Listeria seeligeri: lse_2084Help
Entry
lse_2084          CDS       T01184                                 

Definition
class II aldolase/adducin domain-containing protein
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
lsg  Listeria seeligeri
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:lsg00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    lse_2084
Enzymes [BR:lsg01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     lse_2084
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2138233..2138883)
Genome map
AA seq 216 aa AA seqDB search
MLYQKEREDLAKIVKTMFDRFETNAAGGNVSVRMNNEHIIMTPTLMSQARLCDLSPYEIL
VVDNNNEVVEGDGRITREINLHRACYVENPDIGCVLHAHPKESMLFATLGMELPNLTEAT
QKLGQIPTLTFAPATSPELAEIVRKHVIELGDKAVPSASLLNKHGIVVLESTLHKAYDML
ERIEYNAYIAEKAMVFDALGIKKLVHDGELNYNLEE
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atgttataccaaaaagagcgtgaagatttagcgaaaatagtgaagacaatgtttgatcgt
tttgaaacgaatgccgcgggtggaaatgtcagcgtgcgtatgaataacgagcatattatt
atgacgccaaccttaatgagtcaagcacggctttgtgacctgtcaccatatgaaatttta
gtcgtggataataataatgaagtggtagaaggagacggtagaatcacgcgggaaattaat
ttgcatcgtgcttgttacgtagaaaatccggatatcggttgtgtacttcatgcgcatcca
aaagaatccatgttgttcgcaacgcttggcatggagcttccaaatttaacagaagcaacg
caaaaattaggacaaatccctacactaacttttgccccagctacaagtccagaactagca
gaaatcgttcggaaacatgtcattgaattaggcgataaagctgttcccagtgctagctta
cttaataaacacggaattgtggtattagaatccactttgcataaagcatacgatatgtta
gagcgaattgagtataatgcttatattgccgaaaaagcgatggttttcgatgcattaggt
attaaaaaactagtacacgacggggaattaaattataatctggaggagtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system