KEGG   Listeria seeligeri: lse_2376Help
Entry
lse_2376          CDS       T01184                                 

Gene name
mro
Definition
aldose 1-epimerase
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
lsg  Listeria seeligeri
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:lsg00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:lsg00052]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2446228..2447298)
Genome map
AA seq 356 aa AA seqDB search
MISIEVKKQYFGDLAGETVWQWTMINDHGMKMSVLNYGAIITSVETIDKFGEFANISLGF
TKLEDYLAYSPYFGAVVGPVAGRITKGQFNLDGNRFQLSRNDGANSLHGGKGNFSKRMWD
VTVEEQPDQIVMTFYYQWADRENGYPGKIDTKMTYTLNNKNEWIINYEAETEKPTIYNPS
NHIYFNLTGDAGSTVLGHQLMVNSERFLPVDDETLPIGENRPVKDSIFDLQAAREIAEIT
SSDNEQIKIVGAGLDHAFVLKHENERPDAVLFEPTSGRCIEMETTSESVVVYTANSLSSK
FEIDKKPVPKYAGITMETQGLVDAINQPGFGDIVLRPGETFTANTTFRFTVDRRNI
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
gtgatctctatcgaagttaaaaaacaatattttggtgatttagcaggagaaactgtttgg
cagtggacaatgataaatgaccatggaatgaaaatgagcgttttgaattatggagcaatt
atcacttctgttgaaacaatcgacaaatttggtgaatttgcgaatattagtcttggattt
acaaaattggaggattatttggcttattcaccatattttggtgcagttgttgggccggtt
gcaggacggattacgaaaggacaatttaatctagatggaaatcggttccaattatcgcga
aatgatggtgcaaactcgcttcacggcggtaaaggtaattttagtaaaagaatgtgggat
gtcactgttgaagaacagccagatcaaatcgtgatgactttttactatcaatgggcggat
agagaaaatggctatccggggaaaatagatacgaaaatgacgtatacgctaaataataag
aatgaatggataattaattatgaagcagagacggaaaaaccaaccatttacaatccgagc
aatcatatttactttaatctcactggtgatgctggctccactgtgttaggacatcaactt
atggttaatagtgaacgtttcttgccggtagacgatgaaacactgccaatcggtgaaaat
cgacctgtgaaagattcaatatttgatttgcaagcagctcgtgaaatagctgaaattact
agtagtgataatgagcaaataaaaatagttggcgctggacttgaccatgcttttgttttg
aaacatgaaaatgaacgtccagatgcagttttatttgagcctacttcaggtagatgtatc
gaaatggaaacaacttcagaatcagtcgttgtttataccgcgaatagtttgtcgagtaaa
tttgaaatcgacaagaagccagtaccaaagtacgcgggaataaccatggaaacacagggc
ttggttgatgctattaatcaaccgggatttggtgatattgtgctaagacctggagaaaca
tttacagctaacactactttccgctttaccgtagatagacgaaatatctag

DBGET integrated database retrieval system