KEGG   Listeria seeligeri: lse_2447Help
Entry
lse_2447          CDS       T01184                                 

Gene name
thrC
Definition
(GenBank) thrC
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
lsg  Listeria seeligeri
Pathway
lsg00260  Glycine, serine and threonine metabolism
lsg00750  Vitamin B6 metabolism
lsg01100  Metabolic pathways
lsg01110  Biosynthesis of secondary metabolites
lsg01120  Microbial metabolism in diverse environments
lsg01230  Biosynthesis of amino acids
Module
lsg_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:lsg00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    lse_2447 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    lse_2447 (thrC)
Enzymes [BR:lsg01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     lse_2447 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Peripla_BP_6 PK_C
Motif
Other DBs
NCBI-ProteinID: CBH28598
Position
complement(2517075..2518130)
Genome map
AA seq 351 aa AA seqDB search
MYKGLLEKYKEYLPVTENTPMISLAEGNTPLIPLPNLSKELGVTLYGKYEGLNPTGSFKD
RGMVMAVAKAKEEGAEAVICASTGNTSAAAAAYATRAGLKAYIVIPEGKVALGKLAQAVM
YGADIISIQGNFDEALKSVRELAKTEAVTLVNSVNPYRLEGQKTAAFEICEQLGSAPDVL
AIPVGNAGNISAYWKGFKEWNDAHNSGLPRMHGFEAEGAAAIVQGKAIANPETIATAIRI
GNPASWGLAEAARDESKGYIHSVTDDEIVNAYKKIAAQDGVFIEPGSAASLAGVIQHVAN
GTIKKGETVVCVFTGNGLKDPDTAMSVHEIPISHVDDIEAMRTHLRGGVKA
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgtataaaggtttactcgaaaaatacaaagaatatttaccagtaacagaaaatacgcca
atgatttcacttgcagaaggaaatacaccattaataccactgccaaatttgtccaaagaa
cttggtgttactttatacggaaaatatgagggattaaatccaactggttcttttaaagat
cgcggaatggtaatggccgttgcaaaagcgaaagaagaaggcgctgaggcagttatttgt
gcttcgactgggaacacttcggccgcagcagcagcttatgcaacacgcgccggtttaaaa
gcttatatcgttatcccagaaggtaaagtcgcgcttggaaaattagcgcaagcggttatg
tacggtgcagatattatttctattcaagggaattttgacgaagctttaaaatctgttcgt
gaacttgctaaaacagaagcagtaacgcttgtcaactcagtcaatccttatcgtttagaa
ggacaaaaaacagctgcattcgaaatttgtgaacaacttggctcagcgcctgatgtactt
gctatcccagtaggtaacgcaggaaatatttccgcttattggaaaggcttcaaagaatgg
aatgatgcgcacaactctggtcttccaagaatgcacggctttgaagcggaaggtgcggct
gccatcgttcaagggaaggctattgctaatccagaaacaattgcaacagcgattcgaatt
ggaaatccagctagctggggacttgccgaagccgctcgtgatgaatccaaaggttatatc
cattctgttacagatgatgaaatagtaaatgcttataaaaaaattgccgcacaagatggc
gtttttatcgaaccaggctcggcagcatctttagctggagtgattcaacacgtagcgaac
ggaaccattaaaaaaggggaaacagttgtttgtgtattcactggaaacggcttaaaagat
cccgatactgcaatgagtgtgcatgaaattccgatttctcatgtagatgatatcgaagca
atgcgtacacatcttcgcggaggagtgaaagcttaa

DBGET integrated database retrieval system